PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462904615 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 105aa MW: 11818.6 Da PI: 10.417 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.3 | 8.3e-19 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+llvd+++ G g+W++ ++ g++R++k+c++rw +yl 462904615 15 KGPWTPEEDKLLVDYIEANGHGSWRLLPKLAGLNRCGKSCRLRWTNYL 62 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.8E-24 | 7 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.755 | 10 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 2.5E-14 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.8E-17 | 15 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.82E-24 | 16 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.38E-11 | 17 | 62 | No hit | No description |
PROSITE profile | PS50090 | 4.298 | 63 | 105 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-9 | 65 | 89 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MGRAPCCDRK QGLKKGPWTP EEDKLLVDYI EANGHGSWRL LPKLAGLNRC GKSCRLRWTN 60 YLRPDIKRGP FTPEEEKSII QLHAIVGNNC PAGRTTKSRT TGTRT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-16 | 13 | 88 | 5 | 79 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. | |||||
UniProt | Transcription factor that may play a role in flower development by repressing ANT (PubMed:19232308). Regulates the transition of meristem identity from vegetative growth to flowering. Acts downstream of LFY and upstream of AP1. Directly activates AP1 to promote floral fate. Together with LFY and AP1 may constitute a regulatory network that contributes to an abrupt and robust meristem identity transition (PubMed:21750030). {ECO:0000269|PubMed:19232308, ECO:0000269|PubMed:21750030}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462904615 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK108621 | 1e-112 | AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004953258.1 | 5e-57 | transcription factor MYB41 | ||||
Swissprot | Q9M2D9 | 4e-47 | MYB17_ARATH; Transcription factor MYB17 | ||||
Swissprot | Q9S9Z2 | 6e-47 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | K3YUI8 | 1e-55 | K3YUI8_SETIT; Uncharacterized protein | ||||
STRING | Si017934m | 2e-56 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G61250.1 | 4e-49 | myb domain protein 17 |
Publications ? help Back to Top | |||
---|---|---|---|
|