PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462904615

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 105aa MW: 11818.6 Da PI: 10.417

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462904615	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.3	8.3e-19	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+llvd+++ G g+W++ ++ g++R++k+c++rw +yl 462904615 15 KGPWTPEEDKLLVDYIEANGHGSWRLLPKLAGLNRCGKSCRLRWTNYL 62 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.8E-24	7	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.755	10	66	IPR017930	Myb domain
SMART	SM00717	2.5E-14	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	2.8E-17	15	62	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.82E-24	16	88	IPR009057	Homeodomain-like
CDD	cd00167	2.38E-11	17	62	No hit	No description
PROSITE profile	PS50090	4.298	63	105	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	1.4E-9	65	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
MGRAPCCDRK QGLKKGPWTP EEDKLLVDYI EANGHGSWRL LPKLAGLNRC GKSCRLRWTN 60 YLRPDIKRGP FTPEEEKSII QLHAIVGNNC PAGRTTKSRT TGTRT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-16	13	88	5	79	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.
UniProt	Transcription factor that may play a role in flower development by repressing ANT (PubMed:19232308). Regulates the transition of meristem identity from vegetative growth to flowering. Acts downstream of LFY and upstream of AP1. Directly activates AP1 to promote floral fate. Together with LFY and AP1 may constitute a regulatory network that contributes to an abrupt and robust meristem identity transition (PubMed:21750030). {ECO:0000269\|PubMed:19232308, ECO:0000269\|PubMed:21750030}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462904615

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK108621	1e-112	AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004953258.1	5e-57	transcription factor MYB41
Swissprot	Q9M2D9	4e-47	MYB17_ARATH; Transcription factor MYB17
Swissprot	Q9S9Z2	6e-47	MYB93_ARATH; Transcription factor MYB93
TrEMBL	K3YUI8	1e-55	K3YUI8_SETIT; Uncharacterized protein
STRING	Si017934m	2e-56	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G61250.1	4e-49	myb domain protein 17

Publications ? help Back to Top
Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]