PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462904052 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 145aa MW: 16092.3 Da PI: 12.3897 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54 | 3.9e-17 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEdell + v++ G g+W+t +r+ g+ R++k+c++rw +yl 462904052 21 RGPWSPEEDELLRRFVEREGEGRWRTLPRRAGLVRCGKSCRLRWMNYL 68 89******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.185 | 16 | 72 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.5E-21 | 17 | 70 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-13 | 20 | 70 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.4E-15 | 21 | 68 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.67E-22 | 22 | 96 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.67E-11 | 23 | 68 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-6 | 71 | 97 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MTRKQQTAAA RAGGAGPALK RGPWSPEEDE LLRRFVEREG EGRWRTLPRR AGLVRCGKSC 60 RLRWMNYLRP DIKRGPIAGD EEDLILRLHR LLGNRFIHAR ARSTGGRSSP GGCRGARTTR 120 SRTTGTRTSA GSSSRRASTR APTGR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-14 | 17 | 126 | 3 | 110 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462904052 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 2e-79 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020181361.1 | 6e-45 | transcription repressor MYB5-like | ||||
Swissprot | Q38850 | 1e-39 | MYB5_ARATH; Transcription repressor MYB5 | ||||
TrEMBL | A0A446NL66 | 7e-46 | A0A446NL66_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A453FA65 | 7e-46 | A0A453FA65_AEGTS; Uncharacterized protein | ||||
STRING | MLOC_16037.3 | 3e-44 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 2e-40 | myb domain protein 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|