PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462901191 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 64aa MW: 6937.74 Da PI: 4.4817 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 83.6 | 2.3e-26 | 17 | 64 | 2 | 49 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49 +eqdrflPian+srim++++P+n+ki+kdak++vqecvsefisf+tse 462901191 17 KEQDRFLPIANISRIMRRAVPENGKIAKDAKDSVQECVSEFISFITSE 64 89********************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.8E-23 | 14 | 64 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.03E-16 | 16 | 64 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.3E-17 | 22 | 64 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
MSEGDYTLEG GSGAGGKEQD RFLPIANISR IMRRAVPENG KIAKDAKDSV QECVSEFISF 60 ITSE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-22 | 17 | 64 | 2 | 49 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-22 | 17 | 64 | 2 | 49 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462901191 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC104284 | 3e-67 | AC104284.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1735_C10, complete sequence. | |||
GenBank | AP014961 | 3e-67 | AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012613 | 3e-67 | CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025805143.1 | 2e-28 | nuclear transcription factor Y subunit B-4-like | ||||
Refseq | XP_025805144.1 | 2e-28 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | Q65XK1 | 7e-26 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A0A9PIF8 | 6e-28 | A0A0A9PIF8_ARUDO; Uncharacterized protein | ||||
STRING | Pavir.J18451.1.p | 3e-28 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP18750 | 5 | 9 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.6 | 9e-28 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|