PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462901034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 384aa    MW: 41920.9 Da    PI: 9.7771
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462901034genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT++Ed +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
        462901034 16 RGSWTPQEDMRLIAYIQKHGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding53.26.6e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
        462901034  69 RGNFTAEEEETIIKLHGMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.361163IPR017930Myb domain
SuperFamilySSF466897.11E-3013110IPR009057Homeodomain-like
SMARTSM007171.1E-121565IPR001005SANT/Myb domain
PfamPF002494.1E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-231770IPR009057Homeodomain-like
CDDcd001674.25E-101863No hitNo description
PROSITE profilePS5129424.83464118IPR017930Myb domain
SMARTSM007179.9E-1568116IPR001005SANT/Myb domain
PfamPF002494.2E-1569114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2671118IPR009057Homeodomain-like
CDDcd001676.08E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MGRGRAPCCA KVGLNRGSWT PQEDMRLIAY IQKHGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTAEEEETI IKLHGMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRVAQ  120
REKQKPGAAK SEGTTSGDAG TPNTSSSASS STTTANSSGG GGGDAGEQCG TSKEPDTIDL  180
PPLESDIDIS DMLVDTPTEA LTTCAGGGVV EDLIELPVID IEPEIWSIID GDGADVPDVA  240
GARRGDATVP CTGHAVSTSE AGEANDWWLE NLEKELGLWA PTEDSQAQSD LLGHMSFPVP  300
LGDTEGDPVS TYFQCGPTTA ELQEKKKKKK KKKKKKKKKK KKKKKKKKKK KKKKGGVLYL  360
PQKLCRIVDL WLTQPVKTQT IRDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1339353KKKKKKKKKKKKKKK
2340353KKKKKKKKKKKKKK
3344353KKKKKKKKKK
4345353KKKKKKKKK
5347353KKKKKKK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462901034
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794371e-146HF679437.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB31 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814304.11e-161myb-related protein Zm1-like
SwissprotP200241e-153MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0A9HFK41e-170A0A0A9HFK4_ARUDO; Uncharacterized protein
STRINGGRMZM5G833253_P011e-152(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.18e-71myb domain protein 58
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]