PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462894131 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 76aa MW: 8525.59 Da PI: 5.1105 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 58.4 | 1.8e-18 | 2 | 41 | 56 | 95 |
NF-YB 56 rekrktingddllwalatlGfedyveplkvylkkyreleg 95 +ekrktingddl+w+l+tlGfedyveplk+ylk yre ++ 462894131 2 KEKRKTINGDDLIWSLGTLGFEDYVEPLKLYLKLYREGDT 41 8***********************************9665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.8E-15 | 2 | 54 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.38E-12 | 2 | 55 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MKEKRKTING DDLIWSLGTL GFEDYVEPLK LYLKLYREGD TKGSKTSDQT GKKEILLNGE 60 PGSSLRYGID QGTAEQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462894131 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM078742 | 2e-44 | KM078742.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D11) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025805143.1 | 5e-34 | nuclear transcription factor Y subunit B-4-like | ||||
Refseq | XP_025805144.1 | 5e-34 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | Q65XK1 | 3e-30 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A0A9KDX5 | 3e-33 | A0A0A9KDX5_ARUDO; Uncharacterized protein | ||||
TrEMBL | A0A0A9PIF8 | 9e-33 | A0A0A9PIF8_ARUDO; Uncharacterized protein | ||||
TrEMBL | A0A2T7EA31 | 3e-32 | A0A2T7EA31_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T8KII4 | 3e-32 | A0A2T8KII4_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T8KIK1 | 4e-32 | A0A2T8KIK1_9POAL; Uncharacterized protein | ||||
TrEMBL | K3ZDG1 | 1e-32 | K3ZDG1_SETIT; Uncharacterized protein | ||||
STRING | Sb09g029140.1 | 5e-34 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP25630 | 5 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.7 | 2e-21 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|