PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462891542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB_related
Protein Properties Length: 75aa    MW: 8465.73 Da    PI: 10.6623
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462891542genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26.1e-161456143
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
                     +g+WT+eEde+lv ++k +G g+W++ +r  g+ R++k+c++r
        462891542 14 KGAWTKEEDERLVAYIKAHGEGCWRSLPRAAGLLRCGKSCRLR 56
                     79******************************99*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-17556IPR009057Homeodomain-like
SuperFamilySSF466894.31E-11957IPR009057Homeodomain-like
PROSITE profilePS5129415.412965IPR017930Myb domain
SMARTSM007173.7E-61363IPR001005SANT/Myb domain
PfamPF002491.3E-121456IPR001005SANT/Myb domain
CDDcd001671.18E-81656No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLVAYIK AHGEGCWRSL PRAAGLLRCG KSCRLRRRGR  60
AHHPTPQPAR QQCQA
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462891542
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM1569062e-62AM156906.1 Zea mays mRNA for transcription factor MYB31 (myb31 gene).
GenBankBT0388122e-62BT038812.1 Zea mays full-length cDNA clone ZM_BFb0329H19 mRNA, complete cds.
GenBankHQ8587932e-62HQ858793.1 Zea mays clone UT1854 MYB transcription factor mRNA, partial cds.
GenBankJF9570802e-62JF957080.1 Agropyron cristatum transcription factor myb-like protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016714474.12e-33PREDICTED: myb-related protein 308-like
RefseqXP_017632883.12e-33PREDICTED: myb-related protein 308-like
RefseqXP_020111295.13e-33myb-related protein 308-like
SwissprotQ9SZP17e-34MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0A0K4N05e-33A0A0A0K4N0_CUCSA; MYB domain class transcription factor
STRINGEMT261901e-32(Aegilops tauschii)
STRINGSi011098m2e-32(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-36myb domain protein 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Schenke D,Cai D,Scheel D
    Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification.
    Plant Cell Environ., 2014. 37(7): p. 1716-21
    [PMID:24450952]
  3. Zhou M, et al.
    Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis.
    Plant J., 2015. 84(2): p. 395-403
    [PMID:26332741]
  4. Zhang J, et al.
    Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis.
    Plant Sci., 2016. 248: p. 82-91
    [PMID:27181950]
  5. Zhou M, et al.
    LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis.
    Plant Physiol., 2017. 174(3): p. 1348-1358
    [PMID:28483877]
  6. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  7. Verma N,Burma PK
    Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum.
    Plant J., 2017. 92(3): p. 481-494
    [PMID:28849604]