PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462891542 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 75aa MW: 8465.73 Da PI: 10.6623 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.2 | 6.1e-16 | 14 | 56 | 1 | 43 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 +g+WT+eEde+lv ++k +G g+W++ +r g+ R++k+c++r 462891542 14 KGAWTKEEDERLVAYIKAHGEGCWRSLPRAAGLLRCGKSCRLR 56 79******************************99*******98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.6E-17 | 5 | 56 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 4.31E-11 | 9 | 57 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.412 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 3.7E-6 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-12 | 14 | 56 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.18E-8 | 16 | 56 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDERLVAYIK AHGEGCWRSL PRAAGLLRCG KSCRLRRRGR 60 AHHPTPQPAR QQCQA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462891542 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM156906 | 2e-62 | AM156906.1 Zea mays mRNA for transcription factor MYB31 (myb31 gene). | |||
GenBank | BT038812 | 2e-62 | BT038812.1 Zea mays full-length cDNA clone ZM_BFb0329H19 mRNA, complete cds. | |||
GenBank | HQ858793 | 2e-62 | HQ858793.1 Zea mays clone UT1854 MYB transcription factor mRNA, partial cds. | |||
GenBank | JF957080 | 2e-62 | JF957080.1 Agropyron cristatum transcription factor myb-like protein mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016714474.1 | 2e-33 | PREDICTED: myb-related protein 308-like | ||||
Refseq | XP_017632883.1 | 2e-33 | PREDICTED: myb-related protein 308-like | ||||
Refseq | XP_020111295.1 | 3e-33 | myb-related protein 308-like | ||||
Swissprot | Q9SZP1 | 7e-34 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | A0A0A0K4N0 | 5e-33 | A0A0A0K4N0_CUCSA; MYB domain class transcription factor | ||||
STRING | EMT26190 | 1e-32 | (Aegilops tauschii) | ||||
STRING | Si011098m | 2e-32 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 3e-36 | myb domain protein 4 |