PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462888232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family NAC
Protein Properties Length: 332aa    MW: 37734.4 Da    PI: 6.6265
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462888232genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.68.3e-5671361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPtdeelv++yL+kkv+++k++l +vik+vd+yk+ePwdL++  k+   e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ k+
  462888232   7 VPPGFRFHPTDEELVDYYLRKKVASNKIDL-DVIKDVDLYKIEPWDLQEkcKIGMeEQNDWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKPIYT-KN 104
                69****************************.9***************952433333556**************************************.99 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                 lvg++ktLvfy+grap+g+k+dW+mheyrle
  462888232 105 CLVGMRKTLVFYRGRAPNGQKSDWIMHEYRLE 136
                9*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-615156IPR003441NAC domain
PROSITE profilePS5100559.8737156IPR003441NAC domain
PfamPF023658.8E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MDGSSHVPPG FRFHPTDEEL VDYYLRKKVA SNKIDLDVIK DVDLYKIEPW DLQEKCKIGM  60
EEQNDWYFFS HKDKKYPTGT RTNRATTAGF WKATGRDKPI YTKNCLVGMR KTLVFYRGRA  120
PNGQKSDWIM HEYRLETTEN GTAPEEGWVV CRVFKKRVAM VQRMADRSPC WFDDHHVAGF  180
MPALAHHPNA AYGGQQFYHC KPELEYHHLL PSQETFLPQL PQLESPKPPA AYIGHGSGSL  240
IQSSEEPSKC TAQQPTMDMA YMAAIDDSAT DWRALDKFVA SQLFSHGDGT PKEPSYSNPV  300
PAFHLTENNK REEALDYAST SASGGGEADM WK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-50715717166NO APICAL MERISTEM PROTEIN
1ut4_B4e-50715717166NO APICAL MERISTEM PROTEIN
1ut7_A4e-50715717166NO APICAL MERISTEM PROTEIN
1ut7_B4e-50715717166NO APICAL MERISTEM PROTEIN
4dul_A4e-50715717166NAC domain-containing protein 19
4dul_B4e-50715717166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462888232
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0750930.0KT075093.1 Panicum virgatum secondary wall NAC master switch (SWN8B) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025825485.10.0NAC domain-containing protein 7-like
SwissprotQ9FWX21e-114NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A2S3GRT70.0A0A2S3GRT7_9POAL; Uncharacterized protein
STRINGSi017679m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-106NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]