PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462884366 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 186aa MW: 20803.6 Da PI: 11.1247 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.5 | 7.5e-19 | 25 | 71 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd++l++ v+++G + W+ +ar ++ gR +kqc++rw ++l 462884366 25 RGPWTSEEDDILKNMVREHGERKWAVVARALP-GRIGKQCRERWTNHL 71 89******************************.************996 PP | |||||||
2 | Myb_DNA-binding | 57.7 | 2.7e-18 | 78 | 119 | 2 | 45 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 WT+e+d++l++a+k +G++ W+ Ia+ ++ gR+++ +k++w+ 462884366 78 SHWTEEDDKRLIEAHKTYGNR-WSVIAKFIP-GRSENAVKNHWN 119 67*******************.*********.***********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.928 | 20 | 75 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.04E-31 | 23 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-17 | 24 | 73 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.1E-17 | 25 | 71 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-26 | 26 | 78 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.73E-15 | 27 | 71 | No hit | No description |
SMART | SM00717 | 3.6E-16 | 76 | 124 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.574 | 76 | 126 | IPR017930 | Myb domain |
Pfam | PF00249 | 9.7E-17 | 78 | 119 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.2E-22 | 79 | 121 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.79E-14 | 80 | 119 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MAAGQPRAAG GGNVERAAPP PPPHRGPWTS EEDDILKNMV REHGERKWAV VARALPGRIG 60 KQCRERWTNH LRPDIKKSHW TEEDDKRLIE AHKTYGNRWS VIAKFIPGRS ENAVKNHWNA 120 TRRSLRAKRR LKKKKNAPAS PPGQQLSDLE EYIRALYPGD AAGANYSRAA GFSAVIVQPA 180 ARPGWG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-41 | 21 | 121 | 3 | 103 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for female gametophyte fertility. Acts redundantly with MYB64 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5. {ECO:0000269|PubMed:24068955}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462884366 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006645039.2 | 8e-64 | PREDICTED: protein rough sheath 2-like | ||||
Swissprot | Q9FIM4 | 7e-46 | MY119_ARATH; Transcription factor MYB119 | ||||
TrEMBL | K3XS58 | 3e-59 | K3XS58_SETIT; Uncharacterized protein | ||||
STRING | Si004755m | 4e-60 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1882 | 33 | 101 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58850.1 | 4e-44 | myb domain protein 119 |
Publications ? help Back to Top | |||
---|---|---|---|
|