PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462880287 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 208aa MW: 23696.8 Da PI: 7.1662 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.1 | 2.3e-19 | 40 | 87 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd llv++++++G g+W++ ar g++Rt+k+c++rw++yl 462880287 40 RGPWTVEEDVLLVNYIAKHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 87 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.1 | 6.5e-16 | 93 | 136 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+ E++l+++++ ++G++ W++Ia++++ gRt++++k++w++ 462880287 93 RGNITAAEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 136 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.691 | 35 | 91 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.37E-31 | 37 | 134 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.7E-16 | 39 | 89 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-17 | 40 | 87 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.5E-23 | 41 | 94 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.35E-12 | 42 | 87 | No hit | No description |
PROSITE profile | PS51294 | 18.252 | 92 | 142 | IPR017930 | Myb domain |
SMART | SM00717 | 3.2E-14 | 92 | 140 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-14 | 93 | 136 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.2E-23 | 95 | 141 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.55E-11 | 97 | 136 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MDVTAGGMGF DNLEEMLGTV SPAGSAVSAA GSEDEADLRR GPWTVEEDVL LVNYIAKHGE 60 GRWNSLARSA GLKRTGKSCR LRWLNYLRPD VRRGNITAAE QLLILELHSR WGNRWSKIAQ 120 HLPGRTDNEI KNYWRTRVQK HAKQLRCDVN SRQFRDVVRC IWMPRLLLAA TGRDDDSSMI 180 GLPDFEQLGE FEDNLWSLED LCLHHHCS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-26 | 37 | 140 | 24 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462880287 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF587267 | 1e-116 | EF587267.1 Triticum aestivum R2R3 Myb-like protein (PIMP1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025806553.1 | 2e-92 | transcription factor MYB2-like | ||||
Swissprot | Q10MB4 | 6e-86 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
TrEMBL | A0A2S3H7R2 | 6e-91 | A0A2S3H7R2_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J03771.1.p | 3e-91 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP198 | 38 | 330 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G48000.1 | 2e-79 | myb domain protein 112 |
Publications ? help Back to Top | |||
---|---|---|---|
|