PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462877845

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 88aa MW: 10073.8 Da PI: 9.9293

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462877845	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.7	2e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l++ + G +W+++++ g+ R++k+c++rw +yl 462877845 14 RGPWTAEEDRKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61 89****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.7E-22	5	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.276	9	65	IPR017930	Myb domain
SMART	SM00717	2.3E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	3.4E-15	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.11E-19	15	88	IPR009057	Homeodomain-like
CDD	cd00167	7.42E-10	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.8E-6	64	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.254	66	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MGRQPCCDKL GVKRGPWTAE EDRKLINFIL TNGHCCWRAV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL TDAEEQVVID LHAKLGNR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-15	14	88	7	80	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269\|PubMed:23660402}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462877845

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269\|PubMed:23660402}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT041771	1e-114	BT041771.1 Zea mays full-length cDNA clone ZM_BFb0051B11 mRNA, complete cds.
GenBank	BT062437	1e-114	BT062437.1 Zea mays full-length cDNA clone ZM_BFb0298A24 mRNA, complete cds.
GenBank	HQ858697	1e-114	HQ858697.1 Zea mays clone UT1153 MYB transcription factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004957458.1	8e-62	protein ODORANT1
Swissprot	Q9C7U7	4e-56	MYB20_ARATH; Transcription factor MYB20
TrEMBL	K3ZVW9	2e-60	K3ZVW9_SETIT; Uncharacterized protein
STRING	Si030750m	3e-61	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP79	38	563

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G66230.1	2e-58	myb domain protein 20

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]