PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462876299 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 89aa MW: 10307 Da PI: 10.3263 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.5 | 2.4e-16 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl 462876299 15 KGLWSPEEDQKLRDYIVRYGHGCWSALPAKAGLQRNGKSCRLRWINYL 62 678*******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.369 | 10 | 66 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-22 | 10 | 65 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-11 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-14 | 15 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.13E-21 | 17 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.31E-10 | 18 | 62 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-7 | 66 | 89 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MGCKACQKPK VQYRKGLWSP EEDQKLRDYI VRYGHGCWSA LPAKAGLQRN GKSCRLRWIN 60 YLRPGLKHGM FSREEEDTVM SLHAKLGNK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462876299 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP091592 | 1e-110 | FP091592.1 Phyllostachys edulis cDNA clone: bphylf055c23, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004976342.1 | 5e-58 | transcription factor LAF1 | ||||
Refseq | XP_025823961.1 | 4e-58 | transcription factor LAF1-like | ||||
Swissprot | Q9M0K4 | 4e-38 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | A0A2S3I9F5 | 1e-56 | A0A2S3I9F5_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7CXV3 | 1e-56 | A0A2T7CXV3_9POAL; Uncharacterized protein | ||||
TrEMBL | K3YDJ9 | 1e-56 | K3YDJ9_SETIT; Uncharacterized protein | ||||
STRING | Si012304m | 2e-57 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1707 | 37 | 109 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G48920.1 | 2e-40 | myb domain protein 45 |
Publications ? help Back to Top | |||
---|---|---|---|
|