PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462874353 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 218aa MW: 25443.8 Da PI: 7.7861 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 86.6 | 1.4e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtfskRr+gi KKA E+ vLCdaev v+ifss gkly+y++ 462874353 9 KRIENSTNRQVTFSKRRAGIVKKAREIGVLCDAEVGVVIFSSAGKLYDYCT 59 79***********************************************96 PP | |||||||
2 | K-box | 57.4 | 6.2e-20 | 71 | 163 | 1 | 91 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqR..hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 yq++sgk l+++k++sl+ e++++kke++n+q e+R hl+GedL+sL+ +eL +e++L+++ ++ R+k++++++ + ++ ++ e+e++ + 462874353 71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRlvHLKGEDLNSLQPRELIAIEEALQNGQTNLREKQMDHWRLHKRNGKMLEDEHKLLT 163 89999999************************998888*******************************************999999987665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 9.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.071 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.58E-42 | 2 | 80 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-32 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.2E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.8E-11 | 82 | 164 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.358 | 84 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MGRGKIEIKR IENSTNRQVT FSKRRAGIVK KAREIGVLCD AEVGVVIFSS AGKLYDYCTP 60 RTTLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRLVHL KGEDLNSLQP 120 RELIAIEEAL QNGQTNLREK QMDHWRLHKR NGKMLEDEHK LLTLRAHQQD VELSGGMRDL 180 DIGYQYHQVH HDRDFTSQMP FTFRVQPSHP NLQEDEDE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 8e-19 | 1 | 71 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00080 | ChIP-seq | Transfer from AT5G20240 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462874353 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ726930 | 0.0 | KJ726930.1 Zea mays clone pUT3475 MADS transcription factor (MADS29) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004962034.1 | 1e-144 | MADS-box transcription factor 4 | ||||
Swissprot | Q40703 | 1e-132 | MADS4_ORYSJ; MADS-box transcription factor 4 | ||||
TrEMBL | A0A127J9I8 | 1e-142 | A0A127J9I8_9POAL; PISTILLATA-like MADS-box transcription factor PI-1 | ||||
STRING | Si023214m | 1e-143 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3434 | 38 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G20240.1 | 2e-71 | MIKC_MADS family protein |