PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462869857
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB_related
Protein Properties Length: 88aa    MW: 10279 Da    PI: 9.7169
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462869857genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
        462869857 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     789*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-28564IPR009057Homeodomain-like
PROSITE profilePS5129425.33965IPR017930Myb domain
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002499.6E-171461IPR001005SANT/Myb domain
SuperFamilySSF466891.21E-221688IPR009057Homeodomain-like
CDDcd001677.89E-111761No hitNo description
Gene3DG3DSA:1.10.10.608.8E-96588IPR009057Homeodomain-like
PROSITE profilePS512948.7216688IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIH LHSMLGNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-16118824100MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462869857
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0365351e-98BT036535.2 Zea mays full-length cDNA clone ZM_BFb0120O20 mRNA, complete cds.
GenBankBT0410771e-98BT041077.1 Zea mays full-length cDNA clone ZM_BFc0171O14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025879543.19e-62transcription factor MYB4
SwissprotQ8LPH62e-48MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0E0NVM18e-61A0A0E0NVM1_ORYRU; Uncharacterized protein
STRINGORUFI03G19580.11e-61(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.12e-51myb domain protein 50