PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462857050 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 147aa MW: 16664.9 Da PI: 11.3148 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.8 | 6.9e-15 | 17 | 63 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+WT+eEd l + v+++G + W++I ++ +++Rt+k+c++r+ + 462857050 17 KGPWTAEEDAVLRRHVEEHGREKWSSIQSKGPLRRTGKSCRLRYVNI 63 79******************************************986 PP | |||||||
2 | Myb_DNA-binding | 46.6 | 7.6e-15 | 70 | 114 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+++++E++ + +++G++ W+ Ia++++ gRt++++k++w ++ 462857050 70 KGPFSEDEQKTVFEMQREHGNK-WSMIAKKLP-GRTDNDVKNFWSTH 114 79********************.*********.***********876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.773 | 12 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.25E-28 | 15 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-12 | 16 | 66 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-22 | 18 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.01E-10 | 19 | 64 | No hit | No description |
Pfam | PF13921 | 5.3E-14 | 20 | 79 | No hit | No description |
PROSITE profile | PS51294 | 23.459 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 3.1E-14 | 69 | 117 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.04E-10 | 72 | 114 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-21 | 72 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MAPRRRGGGD PPATVKKGPW TAEEDAVLRR HVEEHGREKW SSIQSKGPLR RTGKSCRLRY 60 VNILDPELKK GPFSEDEQKT VFEMQREHGN KWSMIAKKLP GRTDNDVKNF WSTHQKRLQR 120 NGGGGGGPPI SVAAVRQRDL MRGSLNR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-25 | 15 | 117 | 25 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15694308, PubMed:15618418, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:21285328, PubMed:19300502). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:21285328, PubMed:15694308, PubMed:15618418, PubMed:19300502). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252). {ECO:0000269|PubMed:15618418, ECO:0000269|PubMed:15694308, ECO:0000269|PubMed:19300502, ECO:0000269|PubMed:21285328, ECO:0000269|PubMed:24876252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462857050 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA 159 (miR159); the production of miR159 is stimulated by the anaphase promoting complex/cyclosome (APC/C) (PubMed:21441434). Activated by ARID1 in male germline cells via specific histone acetylation regulation (e.g. H3K9Ac) (PubMed:25057814). {ECO:0000269|PubMed:21441434, ECO:0000269|PubMed:25057814}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020201575.1 | 4e-43 | transcription factor MYB21-like | ||||
Refseq | XP_024317615.1 | 7e-43 | transcription factor MYB80-like | ||||
Swissprot | A0A178VEK7 | 7e-42 | DUO1_ARATH; Transcription factor DUO1 | ||||
TrEMBL | A0A1E5VYD2 | 6e-43 | A0A1E5VYD2_9POAL; Transcription factor GAMYB | ||||
TrEMBL | A0A287WH67 | 1e-44 | A0A287WH67_HORVV; Uncharacterized protein | ||||
STRING | Si015815m | 2e-43 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5700 | 33 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60460.1 | 2e-44 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|