PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462852794 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 204aa MW: 22668.5 Da PI: 8.3995 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.1 | 4.1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT Ede+l+ +vk +G g W+ ++++ g++R++k+c++rw++yl 462852794 14 RGAWTSKEDEILAAYVKAHGEGKWREVPQRAGLRRCGKSCRLRWLNYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.6 | 4.5e-16 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w++ 462852794 67 RGNISDDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 111 7899******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.898 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.24E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.7E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.78E-9 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-23 | 65 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.1E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.662 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 3.2E-14 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.61E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0090379 | Biological Process | secondary cell wall biogenesis involved in seed trichome differentiation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MGRRACCAKE GVKRGAWTSK EDEILAAYVK AHGEGKWREV PQRAGLRRCG KSCRLRWLNY 60 LRPNIKRGNI SDDEEDLIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNS TLGRRAAAVW 120 APKPVRCTGG LFFLRDARPE DETQTRTGGS GEGSDDCSSS AASTFAGADE PCFSGGVGGD 180 WMDDVRALAS FLDSDEEWIR CQMA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-26 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462852794 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY135018 | 1e-115 | AY135018.1 Zea mays PL transcription factor (pl) mRNA, pl-bol3 allele, complete cds. | |||
GenBank | AY135019 | 1e-115 | AY135019.1 Zea mays PL transcription factor (pl) mRNA, pl-W22 allele, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025812125.1 | 1e-103 | anthocyanin regulatory C1 protein-like | ||||
Swissprot | P10290 | 3e-89 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A2S3HKW7 | 1e-101 | A0A2S3HKW7_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7E1M4 | 1e-101 | A0A2T7E1M4_9POAL; Uncharacterized protein | ||||
STRING | GRMZM2G005066_P01 | 7e-96 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 2e-58 | myb domain protein 5 |