PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10029238m
Common NameEUTSA_v10029238mg
Organism
Eutrema salsugineum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 114aa    MW: 12296.2 Da    PI: 11.0254
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10029238mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.91.7e-151546738
                     HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEE CS
           SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevavi 38
                      +rq tf++Rr g+lKKA  LS+LCdaevav+
  Thhalv10029238m 15 NRRQSTFARRRSGLLKKARQLSTLCDAEVAVM 46
                     69****************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.57E-14150IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.783146IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-14158IPR002100Transcription factor, MADS-box
CDDcd001203.08E-14246No hitNo description
PRINTSPR004042.7E-10323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-141446IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MGCGKLMINQ LAHANRRQST FARRRSGLLK KARQLSTLCD AEVAVMSSPS LASSSSSPAP  60
GGCARVSLSK DELSKLQDTT RIHLFGDIIY RRETVAKLQV MTDSRITTVV TQS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12226488, ECO:0000269|PubMed:12743119, ECO:0000269|PubMed:14615187, ECO:0000269|PubMed:15084721, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18305206, ECO:0000269|PubMed:19269998, ECO:0000269|PubMed:19767455, ECO:0000269|PubMed:8953767}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10029238m
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269|PubMed:15686521}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002873627.13e-17agamous-like MADS-box protein AGL15 isoform X2
SwissprotQ388478e-18AGL15_ARATH; Agamous-like MADS-box protein AGL15
TrEMBLV4L4Q63e-76V4L4Q6_EUTSA; Uncharacterized protein
STRINGXP_006397171.15e-77(Eutrema salsugineum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.12e-17AGAMOUS-like 15
Publications ? help Back to Top
  1. Zheng Q,Zheng Y,Perry SE
    Decreased GmAGL15 expression and reduced ethylene synthesis may contribute to reduced somatic embryogenesis in a poorly embryogenic cultivar of Glycine max.
    Plant Signal Behav, 2014.
    [PMID:23838957]
  2. Perry SE,Zheng Q,Zheng Y
    Transcriptome analysis indicates that GmAGAMOUS-Like 15 may enhance somatic embryogenesis by promoting a dedifferentiated state.
    Plant Signal Behav, 2016. 11(7): p. e1197463
    [PMID:27302197]
  3. Cosio C, et al.
    The class III peroxidase PRX17 is a direct target of the MADS-box transcription factor AGAMOUS-LIKE15 (AGL15) and participates in lignified tissue formation.
    New Phytol., 2017. 213(1): p. 250-263
    [PMID:27513887]
  4. Zheng Q,Zheng Y,Ji H,Burnie W,Perry SE
    Gene Regulation by the AGL15 Transcription Factor Reveals Hormone Interactions in Somatic Embryogenesis.
    Plant Physiol., 2016. 172(4): p. 2374-2387
    [PMID:27794101]
  5. Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD
    HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 600-619
    [PMID:29475938]