PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10029104m | ||||||||
Common Name | EUTSA_v10029104mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 79aa MW: 9082.29 Da PI: 4.8672 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30.6 | 7.7e-10 | 35 | 73 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 + +eE++l + +k+ G + W++Ia +++ gRt++++ +w Thhalv10029104m 35 MNQEEEDLVCRMHKLVGDR-WELIAGRIP-GRTAEEIERFW 73 679**************99.*********.*********99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 8.8E-5 | 31 | 78 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.10E-6 | 34 | 73 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.3E-11 | 36 | 74 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.64E-7 | 36 | 74 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-8 | 36 | 74 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010026 | Biological Process | trichome differentiation | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 79 aa Download sequence Send to blast |
MDKHLRTKQP KTDPILAASS STEEVSSLEW EAVNMNQEEE DLVCRMHKLV GDRWELIAGR 60 IPGRTAEEIE RFWVMKNN* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10029104m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519522 | 2e-62 | AY519522.1 Arabidopsis thaliana MYB transcription factor (At4g01060) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006396306.1 | 4e-52 | MYB-like transcription factor ETC3 isoform X1 | ||||
Swissprot | Q9M157 | 1e-30 | ETC3_ARATH; MYB-like transcription factor ETC3 | ||||
TrEMBL | V4L283 | 9e-51 | V4L283_EUTSA; Uncharacterized protein | ||||
STRING | XP_006396306.1 | 2e-51 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01060.1 | 2e-43 | CAPRICE-like MYB3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10029104m |
Entrez Gene | 18014238 |