PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Thhalv10027479m

Common Name

EUTSA_v10027479mg

Organism

Eutrema salsugineum

Taxonomic ID

72664

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

NAC

Protein Properties

Length: 278aa MW: 31588 Da PI: 7.4628

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10027479m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	177.3	4.1e-55	11	136	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 +ppGfrFhPtdeel+++yLk+kv+++ +++ ++i vd++kvePwd+p+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ Thhalv10027479m 11 VPPGFRFHPTDEELITHYLKPKVSNTFFSA-TAIGVVDLNKVEPWDIPRKAKMGEKEWYFFCVRDRKYPTGLRTNRATETGYWKATGKDKEIFK 103 69***********************999.88***********99999************************************* PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++lvg+kktLvfykgrapkg+k+dWvmheyrl Thhalv10027479m 104 -GKSLVGMKKTLVFYKGRAPKGVKSDWVMHEYRL 136 .999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.06E-62	9	161	IPR003441	NAC domain
PROSITE profile	PS51005	58.882	11	161	IPR003441	NAC domain
Pfam	PF02365	6.4E-30	12	136	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 278 aa Download sequence Send to blast
EIVEDGKQID VPPGFRFHPT DEELITHYLK PKVSNTFFSA TAIGVVDLNK VEPWDIPRKA 60 KMGEKEWYFF CVRDRKYPTG LRTNRATETG YWKATGKDKE IFKGKSLVGM KKTLVFYKGR 120 APKGVKSDWV MHEYRLDGKH SIQNLSQIAK NEWVICRIYQ KRADGTKVDF SGLMMLDSHI 180 NRIEPIDLPS LMDCSQRDSF PGSSTHVTCF SDQETEDKRL IQESKDGSGS PVCNDLMFLQ 240 DNYSLKKLLL NGQESQVPGI DPSGLAGTVE LDCFWNF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-54	8	167	14	171	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-54	8	167	14	171	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-54	8	167	14	171	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-54	8	167	14	171	NO APICAL MERISTEM PROTEIN
3swm_A	3e-54	8	167	17	174	NAC domain-containing protein 19
3swm_B	3e-54	8	167	17	174	NAC domain-containing protein 19
3swm_C	3e-54	8	167	17	174	NAC domain-containing protein 19
3swm_D	3e-54	8	167	17	174	NAC domain-containing protein 19
3swp_A	3e-54	8	167	17	174	NAC domain-containing protein 19
3swp_B	3e-54	8	167	17	174	NAC domain-containing protein 19
3swp_C	3e-54	8	167	17	174	NAC domain-containing protein 19
3swp_D	3e-54	8	167	17	174	NAC domain-containing protein 19
4dul_A	3e-54	8	167	14	171	NAC domain-containing protein 19
4dul_B	3e-54	8	167	14	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269\|PubMed:15295076, ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:21303842, ECO:0000269\|PubMed:23340744, ECO:0000269\|PubMed:23459204, ECO:0000269\|PubMed:9351240}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10027479m

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19608714, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:20404534, ECO:0000269\|PubMed:21511905, ECO:0000269\|PubMed:22930749}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF738276	0.0	KF738276.1 Brassica napus NAC transcription factor 92 (NAC92.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006414110.2	0.0	NAC domain-containing protein 92
Swissprot	Q9FKA0	1e-164	NAC92_ARATH; NAC domain-containing protein 92
TrEMBL	V4MQZ2	0.0	V4MQZ2_EUTSA; Uncharacterized protein (Fragment)
STRING	XP_006414110.1	0.0	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM400	28	174

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G39610.1	1e-166	NAC domain containing protein 6

Link Out ? help Back to Top
Phytozome	Thhalv10027479m
Entrez Gene	18031090

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Khan M,Rozhon W,Poppenberger B The role of hormones in the aging of plants - a mini-review. Gerontology, 2014. 60(1): p. 49-55 [PMID:24135638] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast. Plant J., 2015. 81(3): p. 377-87 [PMID:25440717] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Kim H, et al. Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453 [PMID:30065116]