PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10026757m | ||||||||
Common Name | EUTSA_v10026757mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25411.1 Da PI: 7.3521 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.2 | 9.1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr gi+KKA ELS+LCda+va+iifs tgkl+e+ss Thhalv10026757m 9 KKIDNITARQVTFSKRRRGIFKKADELSILCDADVALIIFSATGKLFEFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 60.2 | 8.2e-21 | 84 | 171 | 11 | 98 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + +++ + +l++L k ie +++R+l GedLe L+l+eLq+Le+ Le++l+++ +kK e +++qi+ l k+ el +en++Lr+kl Thhalv10026757m 84 SLNHQPENCNLSRLSKDIEDKTKQLRKLRGEDLEGLNLEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREKL 171 56788888899***************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.3E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.408 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.97E-36 | 2 | 69 | No hit | No description |
SuperFamily | SSF55455 | 1.19E-29 | 3 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.406 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 5.0E-18 | 87 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000060 | Biological Process | protein import into nucleus, translocation | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010220 | Biological Process | positive regulation of vernalization response | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MAREKIRIKK IDNITARQVT FSKRRRGIFK KADELSILCD ADVALIIFSA TGKLFEFSSS 60 RMRDILGRYN LHASNIDKLM DQPSLNHQPE NCNLSRLSKD IEDKTKQLRK LRGEDLEGLN 120 LEELQRLEKL LESGLSRVSE KKGECVMSQI SSLEKRGSEL VDENRRLREK LVTLERAKMM 180 AFKEAMETES ATTNMSSYDS EAPLEDDFSD TSLKLGLPYW E* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 6e-18 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 6e-18 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 6e-18 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 6e-18 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10026757m |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF005158 | 0.0 | AF005158.1 Arabidopsis thaliana MADS-box Protein (AGL24) mRNA, complete cds. | |||
GenBank | BT025171 | 0.0 | BT025171.1 Arabidopsis thaliana At4g24540 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006413417.1 | 1e-160 | MADS-box protein AGL24 | ||||
Swissprot | O82794 | 1e-136 | AGL24_ARATH; MADS-box protein AGL24 | ||||
TrEMBL | V4LW03 | 1e-158 | V4LW03_EUTSA; Uncharacterized protein | ||||
STRING | XP_006413417.1 | 1e-159 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14511 | 15 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G24540.1 | 1e-119 | AGAMOUS-like 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10026757m |
Entrez Gene | 18030581 |