PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10026704m
Common NameEUTSA_v10026704mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 81aa    MW: 9127.62 Da    PI: 10.2379
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10026704mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF103.29e-332171151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Thhalv10026704m 21 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 71
                     79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-401372IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.0811373IPR002100Transcription factor, MADS-box
CDDcd002651.67E-391474No hitNo description
SuperFamilySSF554551.19E-301473IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-341535IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001569IPR002100Transcription factor, MADS-box
PfamPF003198.4E-282269IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-343550IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-345071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MELGGDSSPL RKSGRGKIEI KRIENTTNRQ VTFCKRRNGL LKKAYELSVL CDAEVALIVF  60
SSRGRLYEYS NNRFLLLLCS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-201472260Myocyte-specific enhancer factor 2B
1tqe_Q2e-201472260Myocyte-specific enhancer factor 2B
1tqe_R2e-201472260Myocyte-specific enhancer factor 2B
1tqe_S2e-201472260Myocyte-specific enhancer factor 2B
3mu6_A1e-201472159Myocyte-specific enhancer factor 2A
3mu6_B1e-201472159Myocyte-specific enhancer factor 2A
3mu6_C1e-201472159Myocyte-specific enhancer factor 2A
3mu6_D1e-201472159Myocyte-specific enhancer factor 2A
6c9l_A2e-201472260Myocyte-specific enhancer factor 2B
6c9l_B2e-201472260Myocyte-specific enhancer factor 2B
6c9l_C2e-201472260Myocyte-specific enhancer factor 2B
6c9l_D2e-201472260Myocyte-specific enhancer factor 2B
6c9l_E2e-201472260Myocyte-specific enhancer factor 2B
6c9l_F2e-201472260Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269|PubMed:15254538, ECO:0000269|PubMed:19956801}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10026704m
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269|PubMed:10198637, ECO:0000269|PubMed:11058164, ECO:0000269|PubMed:1675158, ECO:0000269|PubMed:17794879, ECO:0000269|PubMed:18281509, ECO:0000269|PubMed:19783648, ECO:0000269|PubMed:9783581}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0217111e-103AL021711.2 Arabidopsis thaliana DNA chromosome 4, BAC clone F13C5 (ESSA project).
GenBankAL1615491e-103AL161549.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 49.
GenBankCP0026871e-103CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024005545.14e-45floral homeotic protein AGAMOUS
SwissprotP178393e-45AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBLV4MQT84e-50V4MQT8_EUTSA; Uncharacterized protein
STRINGXP_006414034.16e-51(Eutrema salsugineum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-47MIKC_MADS family protein
Publications ? help Back to Top
  1. Huang Z, et al.
    APETALA2 antagonizes the transcriptional activity of AGAMOUS in regulating floral stem cells in Arabidopsis thaliana.
    New Phytol., 2017. 215(3): p. 1197-1209
    [PMID:27604611]
  2. Rong XF, et al.
    Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 756-764
    [PMID:29186581]
  3. Uemura A, et al.
    Regulation of floral meristem activity through the interaction of AGAMOUS, SUPERMAN, and CLAVATA3 in Arabidopsis.
    Plant Reprod, 2018. 31(1): p. 89-105
    [PMID:29218596]