PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Thhalv10026703m

Common Name

EUTSA_v10026704mg

Organism

Eutrema salsugineum

Taxonomic ID

72664

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

M-type_MADS

Protein Properties

Length: 81aa MW: 9127.62 Da PI: 10.2379

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10026703m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	103.2	9e-33	21	71	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Thhalv10026703m 21 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 71 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-40	13	72	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.081	13	73	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.67E-39	14	74	No hit	No description
SuperFamily	SSF55455	1.19E-30	14	73	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.8E-34	15	35	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	15	69	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.4E-28	22	69	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.8E-34	35	50	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.8E-34	50	71	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MELGGDSSPL RKSGRGKIEI KRIENTTNRQ VTFCKRRNGL LKKAYELSVL CDAEVALIVF 60 SSRGRLYEYS NNRFLLLLCS *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
1tqe_R	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
1tqe_S	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
3mu6_A	1e-20	14	72	1	59	Myocyte-specific enhancer factor 2A
3mu6_B	1e-20	14	72	1	59	Myocyte-specific enhancer factor 2A
3mu6_C	1e-20	14	72	1	59	Myocyte-specific enhancer factor 2A
3mu6_D	1e-20	14	72	1	59	Myocyte-specific enhancer factor 2A
6c9l_A	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
6c9l_B	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
6c9l_C	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
6c9l_D	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
6c9l_E	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
6c9l_F	2e-20	14	72	2	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:19956801}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10026703m

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269\|PubMed:10198637, ECO:0000269\|PubMed:11058164, ECO:0000269\|PubMed:1675158, ECO:0000269\|PubMed:17794879, ECO:0000269\|PubMed:18281509, ECO:0000269\|PubMed:19783648, ECO:0000269\|PubMed:9783581}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AL021711	1e-103	AL021711.2 Arabidopsis thaliana DNA chromosome 4, BAC clone F13C5 (ESSA project).
GenBank	AL161549	1e-103	AL161549.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 49.
GenBank	CP002687	1e-103	CP002687.1 Arabidopsis thaliana chromosome 4 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024005545.1	4e-45	floral homeotic protein AGAMOUS
Swissprot	P17839	3e-45	AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBL	V4MQT8	4e-50	V4MQT8_EUTSA; Uncharacterized protein
STRING	XP_006414034.1	6e-51	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	1e-47	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Thhalv10026703m
Entrez Gene	18030280

Publications ? help Back to Top
Huang Z, et al. APETALA2 antagonizes the transcriptional activity of AGAMOUS in regulating floral stem cells in Arabidopsis thaliana. New Phytol., 2017. 215(3): p. 1197-1209 [PMID:27604611] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Uemura A, et al. Regulation of floral meristem activity through the interaction of AGAMOUS, SUPERMAN, and CLAVATA3 in Arabidopsis. Plant Reprod, 2018. 31(1): p. 89-105 [PMID:29218596]