PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Thhalv10025957m

Common Name

EUTSA_v10025957mg

Organism

Eutrema salsugineum

Taxonomic ID

72664

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

NZZ/SPL

Protein Properties

Length: 276aa MW: 30292.7 Da PI: 9.029

Description

NZZ/SPL family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10025957m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NOZZLE	185.2	5.7e-57	1	140	1	149
NOZZLE 1 matslffmstdqnsvrnpnellrntrlvvnssgeirte.tkksrgrkpgsktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssva 93 matslff+ tdqn npnel rnt+ v n sgeirte ++k+rgrkpgskt+qq+qkkp rgmg+a+ler +ie ekkk +va+ gdts Thhalv10025957m 1 MATSLFFIPTDQN---NPNELQRNTHHV-NGSGEIRTEpQQKTRGRKPGSKTGQQNQKKPKRRGMGMAQLERIRIEGEKKKTAVAGGGDTS--- 87 9*********9...9******9.*****778**********************************************... PP NOZZLE 94 aisntatrlpvpvdrgvvlqgfps.......slgssrilcggvgsgqvmidpvispwgfvets 149 +trlp d+gvvlqgfps s +sr++cggvgsgq+mi+ pwgfvet Thhalv10025957m 88 ---AITTRLP---DPGVVLQGFPSyggpttaSSFGSRLYCGGVGSGQIMIE----PWGFVETP 140 ...3479...********999988755569*********97....6***96 PP
2	NOZZLE	211	8.2e-65	141	275	169	314
NOZZLE 169 nnrcdtcf.kkkrldgdqnnvvrsngggfskytmipppmngydeyllqsdhhqrsqgflydqriaraasvsaasasinpyfneatnltgsreef 261 n r dtcf kkkrldgd++nvvrsngggfskytmipppmngyd+ ll++d qr qgf+yd+r+ar+a sa+ s pyf eatn+tg +ef Thhalv10025957m 141 NIRYDTCFiKKKRLDGDDQNVVRSNGGGFSKYTMIPPPMNGYDH-LLPPD--QRNQGFFYDHRLARSA--SAS--SNHPYFHEATNHTGLLDEF 227 7799*97899***************************9.*..***********9..555..458************ PP NOZZLE 262 gsvlegnprngsrgvkeyeffpgkydervskvakvaslvgdcspn..tidlslkl 314 s nprng++ vkeyeffp kyde s va++vgdcspn tidlslkl Thhalv10025957m 228 ESG---NPRNGTGDVKEYEFFPRKYDETDS----VATSVGDCSPNisTIDLSLKL 275 996...*****************887....689***************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF08744	9.0E-113	3	275	IPR014855	Plant transcription factor NOZZLE

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0048653	Biological Process	anther development
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 276 aa Download sequence Send to blast
MATSLFFIPT DQNNPNELQR NTHHVNGSGE IRTEPQQKTR GRKPGSKTGQ QNQKKPKRRG 60 MGMAQLERIR IEGEKKKTAV AGGGDTSAIT TRLPDPGVVL QGFPSYGGPT TASSFGSRLY 120 CGGVGSGQIM IEPWGFVETP NIRYDTCFIK KKRLDGDDQN VVRSNGGGFS KYTMIPPPMN 180 GYDHLLPPDQ RNQGFFYDHR LARSASASSN HPYFHEATNH TGLLDEFESG NPRNGTGDVK 240 EYEFFPRKYD ETDSVATSVG DCSPNISTID LSLKL*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator of sporocyte development (PubMed:10465788). Acts as an adapter-like transcriptional repressor recruiting TPL/TPR corepressors to inhibit TCP transcription factors (PubMed:25378179). Required for nucellus and embryo sac development (PubMed:10500234). Plays a central role in patterning both the proximal-distal and the adaxial-abaxial axes during ovule development (PubMed:12183381). Involved in establishing the prospective chalaza of the ovule and in controlling the cell number and the length of the funiculus, and is required for the development of the integuments (PubMed:10976054). Required, with BEL1, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). Involved in controlling stamen identity (PubMed:19726570). May also regulate the morphology of lateral organs by repressing auxin production (PubMed:18557819). {ECO:0000269\|PubMed:10465788, ECO:0000269\|PubMed:10500234, ECO:0000269\|PubMed:10976054, ECO:0000269\|PubMed:12183381, ECO:0000269\|PubMed:18557819, ECO:0000269\|PubMed:19726570, ECO:0000269\|PubMed:22786869, ECO:0000269\|PubMed:25378179}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10025957m

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by the transcription factor AGAMOUS (PubMed:15254538). Regulated by ATXR3/SDG2 via chromatin methylation (PubMed:21037105). Triggered by TGA9 AND TGA10 in anthers (PubMed:20805327). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:20805327, ECO:0000269\|PubMed:21037105}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB493704	4e-39	AB493704.1 Arabidopsis thaliana At4g27330 mRNA for hypothetical protein, partial cds, clone: RAAt4g27330.
GenBank	AF159255	4e-39	AF159255.1 Arabidopsis thaliana sporocyteless (SPL) mRNA, complete cds.
GenBank	DQ446873	4e-39	DQ446873.1 Arabidopsis thaliana clone pENTR221-At4g27330 sporocyteless (At4g27330) mRNA, complete cds.
GenBank	DQ653227	4e-39	DQ653227.1 Arabidopsis thaliana clone 0000017356_0000012141 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024005795.1	0.0	protein SPOROCYTELESS
Swissprot	O81836	1e-110	SPL_ARATH; Protein SPOROCYTELESS
TrEMBL	V4MGZ8	0.0	V4MGZ8_EUTSA; Uncharacterized protein
STRING	XP_006413089.1	0.0	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM13435	18	28

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G27330.1	1e-112	sporocyteless (SPL)

Link Out ? help Back to Top
Phytozome	Thhalv10025957m
Entrez Gene	18028174

Publications ? help Back to Top
Armenta-Medina A,Huanca-Mamani W,Sanchez-León N,Rodríguez-Arévalo I,Vielle-Calzada JP Functional analysis of sporophytic transcripts repressed by the female gametophyte in the ovule of Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e76977 [PMID:24194852] Xue XY, et al. Interaction between two timing microRNAs controls trichome distribution in Arabidopsis. PLoS Genet., 2014. 10(4): p. e1004266 [PMID:24699192] Zhao L, et al. Comparative expression profiling reveals gene functions in female meiosis and gametophyte development in Arabidopsis. Plant J., 2014. 80(4): p. 615-28 [PMID:25182975] Yuan L,Sundaresan V Spore formation in plants: sporocyteless and more. Cell Res., 2015. 25(1): p. 7-8 [PMID:25512340] Picó S,Ortiz-Marchena MI,Merini W,Calonje M Deciphering the Role of POLYCOMB REPRESSIVE COMPLEX1 Variants in Regulating the Acquisition of Flowering Competence in Arabidopsis. Plant Physiol., 2015. 168(4): p. 1286-97 [PMID:25897002] Mao Y, et al. Development of germ-line-specific CRISPR-Cas9 systems to improve the production of heritable gene modifications in Arabidopsis. Plant Biotechnol. J., 2016. 14(2): p. 519-32 [PMID:26360626] Rojas-Gracia P, et al. The parthenocarpic hydra mutant reveals a new function for a SPOROCYTELESS-like gene in the control of fruit set in tomato. New Phytol., 2017. 214(3): p. 1198-1212 [PMID:28134991] Zhao F, et al. Phosphorylation of SPOROCYTELESS/NOZZLE by the MPK3/6 Kinase Is Required for Anther Development. Plant Physiol., 2017. 173(4): p. 2265-2277 [PMID:28209842] Bi H,Fan W,Zhang P C4 Protein of Sweet Potato Leaf Curl Virus Regulates Brassinosteroid Signaling Pathway through Interaction with AtBIN2 and Affects Male Fertility in Arabidopsis. Front Plant Sci, 2017. 8: p. 1689 [PMID:29021807]