PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10017496m | ||||||||
Common Name | EUTSA_v10017496mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 77aa MW: 8123.87 Da PI: 10.7983 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 135.6 | 1.2e-42 | 8 | 76 | 2 | 70 |
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ++a++eakGlnPGlivllvvggll++fl++ny++y+yaqk+lPP+kkkP+skkklkreklkqGv+vPGe Thhalv10017496m 8 GKAAAEAKGLNPGLIVLLVVGGLLVTFLIANYVMYMYAQKTLPPKKKKPISKKKLKREKLKQGVPVPGE 76 57899***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 9.5E-39 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
ProDom | PD019013 | 0.003 | 33 | 76 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 77 aa Download sequence Send to blast |
MSSEGSAGKA AAEAKGLNPG LIVLLVVGGL LVTFLIANYV MYMYAQKTLP PKKKKPISKK 60 KLKREKLKQG VPVPGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10017496m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF372892 | 3e-83 | AF372892.1 Arabidopsis thaliana At2g37120/T2N18.12 mRNA, complete cds. | |||
GenBank | AY085439 | 3e-83 | AY085439.1 Arabidopsis thaliana clone 1517 mRNA, complete sequence. | |||
GenBank | BT002669 | 3e-83 | BT002669.1 Arabidopsis thaliana At2g37120/T2N18.12 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006410892.1 | 7e-46 | DNA-binding protein S1FA2 | ||||
Swissprot | Q42337 | 2e-28 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | V4LP38 | 2e-44 | V4LP38_EUTSA; Uncharacterized protein | ||||
STRING | XP_006410892.1 | 3e-45 | (Eutrema salsugineum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37120.1 | 5e-07 | S1FA-like DNA-binding protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10017496m |
Entrez Gene | 18026797 |