PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10015013m | ||||||||
Common Name | EUTSA_v10015013mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 130aa MW: 15244.6 Da PI: 9.0239 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 27.4 | 9e-09 | 13 | 49 | 3 | 39 |
HHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHH CS HSF_DNA-bind 3 lkklyeiledeelkeliswsengnsfvvldeeefakk 39 ++ly+++++++++++ sws++g+sf+v+++ efa+k Thhalv10015013m 13 FTRLYNMVDNPATDSIASWSQSGKSFIVWNPVEFARK 49 579*******************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00415 | 1.6E-7 | 8 | 80 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 4.7E-9 | 10 | 49 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.9E-12 | 14 | 77 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 2.9E-6 | 14 | 50 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MLGIERNSDE ALFTRLYNMV DNPATDSIAS WSQSGKSFIV WNPVEFARKK FRMVGFETNE 60 YANDNFVRGQ PQLMKNIPKL DMFITKEDAM EYNNILRKEK EELLAALRKQ ELQIKELKYH 120 LQHVRVCKL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10015013m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010518819.1 | 7e-20 | PREDICTED: heat stress transcription factor A-4a | ||||
Swissprot | O49403 | 5e-16 | HFA4A_ARATH; Heat stress transcription factor A-4a | ||||
TrEMBL | V4KZ17 | 1e-91 | V4KZ17_EUTSA; Uncharacterized protein | ||||
STRING | XP_006401777.1 | 2e-92 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM19542 | 5 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18870.1 | 4e-18 | HSF family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10015013m |
Entrez Gene | 18016432 |
Publications ? help Back to Top | |||
---|---|---|---|
|