PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10014943m | ||||||||
Common Name | EUTSA_v10014943mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 148aa MW: 16976.1 Da PI: 9.8021 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.9 | 8.5e-33 | 68 | 126 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt+ gC+vkk+v+r + d++vv++tYeg H h+ Thhalv10014943m 68 LDDGYRWRKYGQKAVKNNKFPRSYYRCTYGGCNVKKQVQRLTADQEVVVTTYEGVHSHP 126 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.4E-33 | 53 | 126 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.35E-29 | 60 | 127 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.895 | 63 | 128 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.2E-38 | 68 | 127 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.2E-26 | 69 | 126 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
GO:0010055 | Biological Process | atrichoblast differentiation | ||||
GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MEGFDNGSLY APFLSLKSHQ NLAKSELLHQ GEEEASKARE GSSRSVELKK KGKKQKFAFQ 60 TRSQVDILDD GYRWRKYGQK AVKNNKFPRS YYRCTYGGCN VKKQVQRLTA DQEVVVTTYE 120 GVHSHPIEKS TENFEHILTQ MQIYSSF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-29 | 52 | 125 | 1 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-29 | 52 | 125 | 1 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00506 | DAP | Transfer from AT5G13080 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10014943m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK352774 | 0.0 | AK352774.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-02-I01. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006399794.1 | 1e-107 | probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 2e-82 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | E4MW77 | 1e-106 | E4MW77_EUTHA; mRNA, clone: RTFL01-02-I01 | ||||
TrEMBL | V4LFQ1 | 1e-106 | V4LFQ1_EUTSA; Uncharacterized protein | ||||
STRING | XP_006399794.1 | 1e-107 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 5e-83 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10014943m |
Entrez Gene | 18016751 |