PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10014754m | ||||||||
Common Name | EUTSA_v10014754mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 192aa MW: 22022 Da PI: 9.6845 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.5 | 9.7e-16 | 11 | 58 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W +eEd +l+ +++ +G g+W+ I+r+ g++R +k+c++rw +yl Thhalv10014754m 11 RGLWKPEEDMILKSYIETHGEGNWADISRRSGLKRGGKSCRLRWKNYL 58 788*****************************99************97 PP | |||||||
2 | Myb_DNA-binding | 50.4 | 5.2e-16 | 64 | 109 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++++E++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l Thhalv10014754m 64 RGGMSPQEQDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 109 6779******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.794 | 6 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.49E-29 | 9 | 105 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.5E-14 | 10 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.4E-14 | 11 | 58 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.2E-22 | 12 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.39E-10 | 14 | 58 | No hit | No description |
PROSITE profile | PS51294 | 24.584 | 59 | 113 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-15 | 63 | 111 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-14 | 64 | 109 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-23 | 66 | 112 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.20E-11 | 67 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010026 | Biological Process | trichome differentiation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MEKEGKSHVK RGLWKPEEDM ILKSYIETHG EGNWADISRR SGLKRGGKSC RLRWKNYLRP 60 NIKRGGMSPQ EQDLIIRMHK LLGNRWSLIA GRLPGRTDNE VKNYWNTHLN KKSSSRKQNA 120 PESVEATPFI DKPVMSTEEV RRSHGEGGEG EEEVDTTWMN RIGSPLPLIT HYPDTLVFDP 180 CFAFTDFFPL L* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-23 | 9 | 112 | 25 | 127 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10014754m |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519637 | 1e-143 | AY519637.1 Arabidopsis thaliana MYB transcription factor (At5g52600) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006401804.1 | 1e-141 | transcription factor MYB82 | ||||
Swissprot | Q9LTF7 | 1e-114 | MYB82_ARATH; Transcription factor MYB82 | ||||
TrEMBL | V4LLA9 | 1e-140 | V4LLA9_EUTSA; Uncharacterized protein | ||||
STRING | XP_006401804.1 | 1e-140 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52600.1 | 1e-111 | myb domain protein 82 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10014754m |
Entrez Gene | 18017688 |