PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10014716m | ||||||||
Common Name | EUTSA_v10014716mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 203aa MW: 23380.4 Da PI: 10.3655 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.9 | 1.3e-28 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+ienk+ rqvtfskRr g++KKA+ELSvLCda+va +ifs++g+lye++ Thhalv10014716m 9 KKIENKTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAMIFSQKGRLYEFA 58 68***********************************************8 PP | |||||||
2 | K-box | 67.2 | 5.8e-23 | 85 | 172 | 11 | 98 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 e+ + ++e++ + k+ie Lq +R+l+G++L+ +s+keLq++ ++Leksl +Rs+K +l+ +++e+l+ ke el++e +L +++ Thhalv10014716m 85 EQYVQGIKKEMETMVKKIEVLQAHNRKLMGQSLSFCSVKELQEIATKLEKSLHIVRSRKAKLYEDEVEKLKAKEMELKDERVRLCARI 172 56678899************************************************************************99998776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.357 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.5E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.06E-31 | 3 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.00E-39 | 3 | 75 | No hit | No description |
Pfam | PF00319 | 3.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.401 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.3E-22 | 89 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MVRGKIQIKK IENKTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAMIFSQ KGRLYEFANS 60 DIKKTIKRYA EYKGAYFVAD SKPIEQYVQG IKKEMETMVK KIEVLQAHNR KLMGQSLSFC 120 SVKELQEIAT KLEKSLHIVR SRKAKLYEDE VEKLKAKEME LKDERVRLCA RIGERPMGMP 180 TGSKEKEDVE TDLFIGFPKN RP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-20 | 1 | 72 | 1 | 72 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10014716m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ447061 | 0.0 | DQ447061.1 Arabidopsis thaliana clone pENTR221-At5g51860 MADS-box protein (At5g51860) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006401902.1 | 1e-146 | MADS-box protein AGL72 | ||||
Swissprot | Q9FLH5 | 1e-121 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | V4KZF2 | 1e-145 | V4KZF2_EUTSA; Uncharacterized protein | ||||
STRING | XP_006401902.1 | 1e-146 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 1e-126 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10014716m |
Entrez Gene | 18018199 |
Publications ? help Back to Top | |||
---|---|---|---|
|