PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10014683m | ||||||||
Common Name | EUTSA_v10014683mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 209aa MW: 24174.1 Da PI: 9.5056 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.9 | 1.7e-25 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien nr vtfskRrng+ KKA+E+ vLCda+va+iif+s+gk+ +y+ Thhalv10014683m 9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMTDYC 58 79*********************************************997 PP | |||||||
2 | K-box | 82.6 | 8.7e-28 | 71 | 169 | 1 | 99 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 yqk sgk+l++ak+e+l++e++++kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R++++e+l+++ ++ +++ +e+++ n +L Thhalv10014683m 71 YQKLSGKKLWDAKHENLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVREHQMEFLMTKRRNEKMMVEENRQLNFQL 164 899******************************************************************************************* PP K-box 95 rkkle 99 +++ + Thhalv10014683m 165 QQQEM 169 *9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.375 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.6E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.11E-34 | 2 | 96 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.89E-38 | 2 | 80 | No hit | No description |
PRINTS | PR00404 | 4.7E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.7E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.8E-17 | 82 | 164 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.041 | 84 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIIFAS NGKMTDYCCP 60 SMDFGAMLDQ YQKLSGKKLW DAKHENLSNE IDRIKKENDS LQLELRHLKG EDIQSLNLKN 120 LMAVEHAIEH GLDKVREHQM EFLMTKRRNE KMMVEENRQL NFQLQQQEMA IASNARGMMM 180 RDHDAQFGFR VQPIQPNLQE KIMSLVID* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 2e-16 | 1 | 91 | 1 | 83 | MEF2 CHIMERA |
6bz1_B | 2e-16 | 1 | 91 | 1 | 83 | MEF2 CHIMERA |
6bz1_C | 2e-16 | 1 | 91 | 1 | 83 | MEF2 CHIMERA |
6bz1_D | 2e-16 | 1 | 91 | 1 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with APETALA3 that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00080 | ChIP-seq | Transfer from AT5G20240 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10014683m |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC967963 | 0.0 | KC967963.1 Brassica oleracea var. viridis PI.c (PI.c) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006400591.1 | 1e-153 | floral homeotic protein PISTILLATA | ||||
Swissprot | P48007 | 1e-146 | PIST_ARATH; Floral homeotic protein PISTILLATA | ||||
TrEMBL | V4LED8 | 1e-152 | V4LED8_EUTSA; Uncharacterized protein | ||||
STRING | XP_006400591.1 | 1e-153 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5300 | 27 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G20240.1 | 1e-149 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10014683m |
Entrez Gene | 18018442 |
Publications ? help Back to Top | |||
---|---|---|---|
|