PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10014613m | ||||||||
Common Name | EUTSA_v10014613mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 223aa MW: 25425.2 Da PI: 6.7496 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26 | 2.1e-08 | 5 | 47 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44 WT Ed+ + +a +++ g +W++Ia + Rt+ ++++++ Thhalv10014613m 5 VWTRSEDKMFEQALVLFPEGspnRWERIADQLH--RTAVEVRDHY 47 7*******************************7..*********9 PP | |||||||
2 | Myb_DNA-binding | 42.9 | 1.2e-13 | 100 | 144 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+ E++l++ + k++G+g+W++I+r + +Rt+ q+ s+ qky Thhalv10014613m 100 PWTENEHKLFLIGLKRYGKGDWRSISRNVVVTRTPTQVASHAQKY 144 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.344 | 1 | 55 | IPR017930 | Myb domain |
SMART | SM00717 | 3.1E-9 | 2 | 53 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.34E-13 | 4 | 59 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 8.9E-7 | 5 | 48 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.97E-7 | 6 | 51 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-5 | 6 | 50 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.261 | 93 | 149 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.77E-16 | 95 | 150 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.8E-16 | 96 | 148 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 7.0E-9 | 97 | 147 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-10 | 99 | 143 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.8E-11 | 100 | 144 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.97E-8 | 100 | 145 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 223 aa Download sequence Send to blast |
MASSVWTRSE DKMFEQALVL FPEGSPNRWE RIADQLHRTA VEVRDHYEAL VHDVIEIDSG 60 RVDVPDYMDD SAAAAAGWDS AGQISFGSKH GESERKRGTP WTENEHKLFL IGLKRYGKGD 120 WRSISRNVVV TRTPTQVASH AQKYFLRQNS VKKERKRSSI HDITTVDTNL AMPGSNMDWS 180 GHHESPVHAQ QQQQQQQQQQ IMTEFGQQMT TPGHFEDFGF RM* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10014613m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493736 | 0.0 | AB493736.1 Arabidopsis thaliana At5g04760 mRNA for hypothetical protein, partial cds, clone: RAAt5g04760. | |||
GenBank | AY050976 | 0.0 | AY050976.1 Arabidopsis thaliana putative I-box binding factor (At5g04760) mRNA, complete cds. | |||
GenBank | AY091177 | 0.0 | AY091177.1 Arabidopsis thaliana putative I-box binding factor (At5g04760) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006398929.1 | 1e-166 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 8e-56 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | V4LDA0 | 1e-165 | V4LDA0_EUTSA; Uncharacterized protein | ||||
STRING | XP_006398929.1 | 1e-166 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5127 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 1e-130 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10014613m |
Entrez Gene | 18018618 |
Publications ? help Back to Top | |||
---|---|---|---|
|