PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10010675m | ||||||||
Common Name | EUTSA_v10010675mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 240aa MW: 26968.8 Da PI: 5.3368 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 57.1 | 6.4e-18 | 2 | 48 | 81 | 128 |
NAM 81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 gyWkatgk+++v+s ++ +g+k+tLvf+ grapkge+t+W+mhey + Thhalv10010675m 2 GYWKATGKERNVKS-GSDIIGTKRTLVFHIGRAPKGERTEWIMHEYCM 48 9*************.999****************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 25.466 | 1 | 64 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 7.06E-20 | 2 | 63 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.9E-8 | 2 | 47 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MGYWKATGKE RNVKSGSDII GTKRTLVFHI GRAPKGERTE WIMHEYCMIG LSLDALVICR 60 LRKNTEHRGA TIQSLPHPNL STDKHANLQN ETISGWENMV DFYLSNESGH ELLSEIAESS 120 QSSQNPQVPS EEDFYADILR DDIVKLDDPT VSGNTLIDVP RLQTESTSTR VMPLPSMVDK 180 QMQSLLQKLP LQNDIGEENN ISMSSCFIGI YSIKSINRAR WDVVAWVLVM IAVLVFYLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-14 | 2 | 64 | 96 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-14 | 2 | 64 | 96 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-14 | 2 | 64 | 96 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-14 | 2 | 64 | 96 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-14 | 2 | 64 | 99 | 168 | NAC domain-containing protein 19 |
3swm_B | 5e-14 | 2 | 64 | 99 | 168 | NAC domain-containing protein 19 |
3swm_C | 5e-14 | 2 | 64 | 99 | 168 | NAC domain-containing protein 19 |
3swm_D | 5e-14 | 2 | 64 | 99 | 168 | NAC domain-containing protein 19 |
3swp_A | 5e-14 | 2 | 64 | 99 | 168 | NAC domain-containing protein 19 |
3swp_B | 5e-14 | 2 | 64 | 99 | 168 | NAC domain-containing protein 19 |
3swp_C | 5e-14 | 2 | 64 | 99 | 168 | NAC domain-containing protein 19 |
3swp_D | 5e-14 | 2 | 64 | 99 | 168 | NAC domain-containing protein 19 |
4dul_A | 5e-14 | 2 | 64 | 96 | 165 | NAC domain-containing protein 19 |
4dul_B | 5e-14 | 2 | 64 | 96 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcription factor involved in modulation of abscisic acid (ABA) signaling. Attenuates ABA sensitivity and glucose-induced ABA accumulation. Reduces the expression of ABI4 gene. {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:24625790}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10010675m |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By glucose (PubMed:24625790). Induced by salt, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:24625790}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK352951 | 0.0 | AK352951.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-19-C18. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006404474.1 | 1e-179 | NAC domain-containing protein 60 isoform X2 | ||||
Refseq | XP_024013527.1 | 1e-178 | NAC domain-containing protein 60 isoform X1 | ||||
Swissprot | Q9LXL9 | 1e-153 | NAC60_ARATH; NAC domain-containing protein 60 | ||||
TrEMBL | E4MWQ4 | 1e-177 | E4MWQ4_EUTHA; mRNA, clone: RTFL01-19-C18 | ||||
TrEMBL | V4LTT7 | 1e-178 | V4LTT7_EUTSA; Uncharacterized protein | ||||
STRING | XP_006404474.1 | 1e-179 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4309 | 23 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G44290.1 | 1e-142 | NAC domain containing protein 60 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10010675m |
Entrez Gene | 18021406 |
Publications ? help Back to Top | |||
---|---|---|---|
|