PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10009386m | ||||||||
Common Name | EUTSA_v10009386mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 167aa MW: 18655.5 Da PI: 9.4726 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 141.1 | 3.5e-44 | 14 | 113 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaCk+lrrkC+kdCv+apyfpa++p kfa+vhk+FGasnv k+l+ l+e++r+da++s+vyeA+ar++dPvyG+vg+i++l++qle+l+++l Thhalv10009386m 14 PCAACKLLRRKCVKDCVFAPYFPAKEPYKFAIVHKIFGASNVNKMLQMLSENHRSDAVNSMVYEANARVQDPVYGCVGTISSLHRQLETLQTQL 107 7********************************************************************************************* PP DUF260 95 allkee 100 a +++e Thhalv10009386m 108 AFAQAE 113 *99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.19 | 13 | 114 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.3E-42 | 14 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MRQKGHRHAG AVSPCAACKL LRRKCVKDCV FAPYFPAKEP YKFAIVHKIF GASNVNKMLQ 60 MLSENHRSDA VNSMVYEANA RVQDPVYGCV GTISSLHRQL ETLQTQLAFA QAELVHIRTL 120 RRIESIRTKP APYTASMGTF PANKDFSTDV DMAFVYEDGA RESLWS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-44 | 10 | 115 | 7 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-44 | 10 | 115 | 7 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10009386m |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cytokinin. {ECO:0000269|PubMed:17485849}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB473842 | 1e-135 | AB473842.1 Arabidopsis thaliana ASL9 mRNA for ASYMMETRIC LEAVES2-like 9 protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006416807.1 | 1e-124 | LOB domain-containing protein 3 | ||||
Swissprot | Q9SA51 | 1e-100 | LBD3_ARATH; LOB domain-containing protein 3 | ||||
TrEMBL | V4KBS8 | 1e-123 | V4KBS8_EUTSA; Uncharacterized protein | ||||
STRING | XP_006416807.1 | 1e-123 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16530.1 | 1e-102 | ASYMMETRIC LEAVES 2-like 9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10009386m |
Entrez Gene | 18993239 |
Publications ? help Back to Top | |||
---|---|---|---|
|