PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10005251m | ||||||||
Common Name | EUTSA_v10005251mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 61aa MW: 6828.9 Da PI: 7.355 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 31.1 | 6e-10 | 12 | 53 | 2 | 43 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpk 43 F k ly ++d+++++++sws++++sf+++d+ f++++L++ Thhalv10005251m 12 FYKALYMFVDDPSMDSIVSWSKSNRSFIIWDPVGFHTRILSR 53 8999***********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46785 | 7.8E-10 | 9 | 53 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Gene3D | G3DSA:1.10.10.10 | 7.0E-11 | 10 | 55 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 3.6E-7 | 12 | 53 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 61 aa Download sequence Send to blast |
MAGLSDRALS PFYKALYMFV DDPSMDSIVS WSKSNRSFII WDPVGFHTRI LSRSIGICEI 60 * |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10005251m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018487557.1 | 5e-15 | PREDICTED: heat stress transcription factor A-4a-like | ||||
TrEMBL | V4KNS5 | 6e-36 | V4KNS5_EUTSA; Uncharacterized protein | ||||
STRING | XP_006394301.1 | 1e-36 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM18172 | 6 | 8 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 4e-12 | heat shock transcription factor A6B |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10005251m |
Entrez Gene | 18012918 |