PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10001738m | ||||||||
Common Name | EUTSA_v10001738mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 99aa MW: 11811.6 Da PI: 10.2623 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103 | 1.7e-32 | 17 | 75 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt++ C+vkk+v+r +++ ++ve+tYeg Hnh+ Thhalv10001738m 17 LDDGYRWRKYGQKSVKNSLYPRSYYRCTQHMCNVKKQVQRLSKERSIVETTYEGIHNHP 75 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.0E-32 | 2 | 75 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.01E-28 | 10 | 76 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 27.451 | 12 | 77 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.7E-36 | 17 | 76 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.8E-26 | 18 | 75 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
MKKSRFAFRT KSDKDILDDG YRWRKYGQKS VKNSLYPRSY YRCTQHMCNV KKQVQRLSKE 60 RSIVETTYEG IHNHPCEEIM QTLTPLLHQM KFLSNFTS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 9e-25 | 7 | 74 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 9e-25 | 7 | 74 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00317 | DAP | Transfer from AT2G46130 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10001738m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF404861 | 1e-103 | AF404861.1 Arabidopsis thaliana WRKY transcription factor 43 splice variant one (WRKY43) mRNA, complete cds; alternatively spliced. | |||
GenBank | AK117931 | 1e-103 | AK117931.1 Arabidopsis thaliana At2g46130 mRNA for putative WRKY transcription factor (WRKY43), complete cds, clone: RAFL19-12-A14. | |||
GenBank | BT004701 | 1e-103 | BT004701.1 Arabidopsis thaliana At2g46130 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006397797.2 | 1e-69 | probable WRKY transcription factor 43 isoform X2 | ||||
Swissprot | Q8GY11 | 5e-64 | WRK43_ARATH; Probable WRKY transcription factor 43 | ||||
TrEMBL | V4KMW8 | 2e-68 | V4KMW8_EUTSA; Uncharacterized protein | ||||
STRING | XP_006397797.1 | 4e-69 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46130.1 | 2e-66 | WRKY DNA-binding protein 43 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10001738m |
Entrez Gene | 18015833 |
Publications ? help Back to Top | |||
---|---|---|---|
|