PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10001365m
Common NameEUTSA_v10001365mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARF
Protein Properties Length: 599aa    MW: 67078.3 Da    PI: 6.7889
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10001365mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3733.7e-23124224198
                      EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      f+k+lt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF +   ++
  Thhalv10001365m 124 FVKILTASDTSTHGGFSVLRKHATEClpsldMRQPTPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLR--GQT 215
                      89****************************9666777789************************************************3..378 PP

                      E..EEEEE- CS
               B3  90 felvvkvfr 98 
                      + l+v+v+r
  Thhalv10001365m 216 GDLRVGVRR 224
                      888**9998 PP

2Auxin_resp96.44.3e-32250329183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha++tk+ F v+Y+Pr   s+F++ v+k+++a+k+ + +GmRf+m+fe+e+s+er ++Gt+vg+ dl++ +Wp SkWrsL+
  Thhalv10001365m 250 ASHAVNTKTLFVVFYKPRI--SQFIIGVNKYMAAMKIGFPIGMRFRMRFEGEESPERIFTGTIVGTGDLSS-QWPASKWRSLQ 329
                      789***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.19E-40109253IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-37118239IPR015300DNA-binding pseudobarrel domain
CDDcd100179.11E-20123224No hitNo description
SMARTSM010192.5E-21124226IPR003340B3 DNA binding domain
PROSITE profilePS5086311.97124226IPR003340B3 DNA binding domain
PfamPF023622.9E-21124224IPR003340B3 DNA binding domain
PfamPF065071.5E-29250329IPR010525Auxin response factor
PfamPF023096.7E-6473523IPR033389AUX/IAA domain
SuperFamilySSF542772.31E-13484563No hitNo description
PROSITE profilePS5174527.02487579IPR000270PB1 domain
PfamPF023091.6E-6533572IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MANVDVDFRR SGSYDDQLYM ELWKACAGPL VEVPRYGERV FYFPQGHMEQ LVALTNQGVV  60
DQEIPDFNLP PKILCRVLSV MLKAEHETDE VYAQITLQPE EDQSEPTSLD PPLVEPAKQS  120
VDSFVKILTA SDTSTHGGFS VLRKHATECL PSLDMRQPTP TQELVARDLH GYEWRFKHIF  180
RGQPRRHLLT TGWSTFVTSK RLVAGDAFVF LRGQTGDLRV GVRRLARQQS TMPASVISSQ  240
SMHLGVLATA SHAVNTKTLF VVFYKPRISQ FIIGVNKYMA AMKIGFPIGM RFRMRFEGEE  300
SPERIFTGTI VGTGDLSSQW PASKWRSLQI QWDEPSTVQR PNKVSTWEIE PFSPSVLTPT  360
PTQPQSKSKR SRPINSSSVS EITGSPIAST FLSLDSNSSL RLLFQDPSTE RNSNKPVFPS  420
GLQCKKTETP VTSCCRLFGF DLMSKPASTA PVPPDKLLIS VDSNNSGSAK CQDPNSLTEQ  480
KQQTSTRSRT KVQKQGTAVG RAVDLTLLRS YDELINELEK MFEIDGELSP KDKWAIVFTD  540
DEGDMMLVGD DPWNEFCKMA KKLFIYSTDE VKKMSTKSSL DDEGTIVNLE LDQRTVYL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1631235313356Auxin response factor 1
4ldw_A1e-1631235313356Auxin response factor 1
4ldw_B1e-1631235313356Auxin response factor 1
4ldx_A1e-1641235313356Auxin response factor 1
4ldx_B1e-1641235313356Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10001365m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533630.0AK353363.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-29-L13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397845.10.0auxin response factor 11 isoform X2
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLV4LHN40.0V4LHN4_EUTSA; Auxin response factor
STRINGXP_006397845.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]