PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943815.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 179aa    MW: 20656.7 Da    PI: 5.7517
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943815.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.31.5e-07751446
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     WT  Ed+ + +a    + g   +W++Ia+ ++ gR++ ++ +r+q 
   XP_010943815.1  7 WTRLEDKAFERALVAIPEGapdRWSLIAAQVP-GRSPTEVWERYQL 51
                     ********************************.***********96 PP

2Myb_DNA-binding45.81.4e-14111155347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qky
   XP_010943815.1 111 PWTEEEHRLFLEGLAKYGRGDWRNISRWAVKTRTPTQVASHAQKY 155
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.666157IPR017930Myb domain
SMARTSM007176.3E-6355IPR001005SANT/Myb domain
SuperFamilySSF466892.28E-11659IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-6754IPR009057Homeodomain-like
CDDcd001671.07E-4753No hitNo description
PfamPF002493.1E-6751IPR001005SANT/Myb domain
PROSITE profilePS5129418.579104160IPR017930Myb domain
SuperFamilySSF466898.97E-18106160IPR009057Homeodomain-like
SMARTSM007171.0E-9108158IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.7E-16109159IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-11111154IPR009057Homeodomain-like
CDDcd001672.41E-10111156No hitNo description
PfamPF002491.1E-11111155IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MEFFRGWTRL EDKAFERALV AIPEGAPDRW SLIAAQVPGR SPTEVWERYQ LLVRDLEMIE  60
RGEVETPGKW DDDDDDDDAG ESTDAAGNSD SRGHQISFGR GRGEERRRGI PWTEEEHRLF  120
LEGLAKYGRG DWRNISRWAV KTRTPTQVAS HAQKYFIRQS QNASNRESKR KSIHDITTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-13568972RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943815.11e-129transcription factor SRM1
SwissprotQ9FNN62e-47SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A2H3YZA53e-95A0A2H3YZA5_PHODC; transcription factor DIVARICATA-like
STRINGXP_008806104.16e-96(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.17e-46MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]