![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010943815.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 179aa MW: 20656.7 Da PI: 5.7517 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 23.3 | 1.5e-07 | 7 | 51 | 4 | 46 |
S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46 WT Ed+ + +a + g +W++Ia+ ++ gR++ ++ +r+q XP_010943815.1 7 WTRLEDKAFERALVAIPEGapdRWSLIAAQVP-GRSPTEVWERYQL 51 ********************************.***********96 PP | |||||||
2 | Myb_DNA-binding | 45.8 | 1.4e-14 | 111 | 155 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++++ +++G g+W+ I+r k+Rt+ q+ s+ qky XP_010943815.1 111 PWTEEEHRLFLEGLAKYGRGDWRNISRWAVKTRTPTQVASHAQKY 155 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 8.666 | 1 | 57 | IPR017930 | Myb domain |
SMART | SM00717 | 6.3E-6 | 3 | 55 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.28E-11 | 6 | 59 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.8E-6 | 7 | 54 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.07E-4 | 7 | 53 | No hit | No description |
Pfam | PF00249 | 3.1E-6 | 7 | 51 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.579 | 104 | 160 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.97E-18 | 106 | 160 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.0E-9 | 108 | 158 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.7E-16 | 109 | 159 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.4E-11 | 111 | 154 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.41E-10 | 111 | 156 | No hit | No description |
Pfam | PF00249 | 1.1E-11 | 111 | 155 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MEFFRGWTRL EDKAFERALV AIPEGAPDRW SLIAAQVPGR SPTEVWERYQ LLVRDLEMIE 60 RGEVETPGKW DDDDDDDDAG ESTDAAGNSD SRGHQISFGR GRGEERRRGI PWTEEEHRLF 120 LEGLAKYGRG DWRNISRWAV KTRTPTQVAS HAQKYFIRQS QNASNRESKR KSIHDITTP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 8e-13 | 5 | 68 | 9 | 72 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010943815.1 | 1e-129 | transcription factor SRM1 | ||||
Swissprot | Q9FNN6 | 2e-47 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A2H3YZA5 | 3e-95 | A0A2H3YZA5_PHODC; transcription factor DIVARICATA-like | ||||
STRING | XP_008806104.1 | 6e-96 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 7e-46 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|