PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943784.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 183aa    MW: 21514.9 Da    PI: 8.5172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943784.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.25.3e-101157145
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     r +WT  Ed+ + +a    + g   +W++Ia++++ gRt+ ++ +++ 
   XP_010943784.1 11 RRAWTRMEDKAFERALVAIPEGtpdRWSLIAAHVP-GRTPRELSEHYE 57
                     679********************************.**********96 PP

2Myb_DNA-binding43.85.9e-14115159347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W+ I+r   k+Rt  q+ s+ qky
   XP_010943784.1 115 PWTEEEHRLFLEGLARYGRGDWRNISRWAVKTRTSTQVASHAQKY 159
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.835664IPR017930Myb domain
SMARTSM007171.4E-91062IPR001005SANT/Myb domain
PfamPF002491.6E-71157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-71159IPR009057Homeodomain-like
SuperFamilySSF466892.35E-111267IPR009057Homeodomain-like
CDDcd001678.96E-71360No hitNo description
PROSITE profilePS5129416.252108164IPR017930Myb domain
SuperFamilySSF466892.55E-17110164IPR009057Homeodomain-like
SMARTSM007171.1E-8112162IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.5E-16113163IPR006447Myb domain, plants
CDDcd001671.63E-9115160No hitNo description
PfamPF002496.3E-11115159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-11115158IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MEFFSIEGEA RRAWTRMEDK AFERALVAIP EGTPDRWSLI AAHVPGRTPR ELSEHYEVLV  60
QDLTVIERGE VEIPREWDDE EVSRSSDAAR TFDHCSPHSF GRARRRSEER RRGIPWTEEE  120
HRLFLEGLAR YGRGDWRNIS RWAVKTRTST QVASHAQKYF IRQNQNASNR DSKRKSIHDI  180
TNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-161274971RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943784.11e-132transcription factor DIVARICATA
RefseqXP_029116633.11e-132transcription factor DIVARICATA
SwissprotQ8S9H71e-46DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A2H3Z6D91e-81A0A2H3Z6D9_PHODC; transcription factor DIVARICATA-like
STRINGXP_008808839.12e-82(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-46MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]