PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010936788.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 124aa MW: 13939.6 Da PI: 4.3918 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 39.7 | 1.2e-12 | 17 | 63 | 39 | 85 |
NF-YB 39 vsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 efi +v+se+++ c re+++ti+++ +l al lGf +y+e++ + XP_010936788.1 17 PKEFINLVSSESNEVCSREEKRTIAPEHVLKALEVLGFGEYIEEVYA 63 47*****************************************9854 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 4.19E-20 | 18 | 111 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.9E-7 | 18 | 49 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 1.8E-21 | 18 | 109 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MEPMDIVGKS KEDVSLPKEF INLVSSESNE VCSREEKRTI APEHVLKALE VLGFGEYIEE 60 VYAAYEQHKL DTLDSPKGGK FSGIEMTEEE ALAEQQRMFA EARARMNNGM TLQKQSDPDH 120 GFNG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 2e-21 | 14 | 103 | 43 | 133 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010936788.1 | 6e-88 | protein Dr1 homolog isoform X2 | ||||
Swissprot | P49592 | 2e-52 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | A0A2H3XS56 | 1e-71 | A0A2H3XS56_PHODC; protein Dr1 homolog | ||||
STRING | XP_008787932.1 | 2e-72 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.3 | 7e-57 | nuclear factor Y, subunit B13 |
Publications ? help Back to Top | |||
---|---|---|---|
|