PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936185.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB_related
Protein Properties Length: 173aa    MW: 19992.3 Da    PI: 10.0407
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936185.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.3e-13108152347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E+ l++++ + +G+g+Wk I+r    ++t  q+ s+ qk+
   XP_010936185.1 108 PWTEKEHRLFLKGLAAYGKGDWKNISRNSVVTKTSSQVASHAQKF 152
                      8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.9961IPR001005SANT/Myb domain
SuperFamilySSF466895.02E-91165IPR009057Homeodomain-like
PROSITE profilePS500904.9721359IPR017877Myb-like domain
PROSITE profilePS5129418.493101157IPR017930Myb domain
SuperFamilySSF466891.79E-14103157IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-16105155IPR006447Myb domain, plants
SMARTSM007173.2E-10105155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-9107149IPR009057Homeodomain-like
PfamPF002491.9E-9108151IPR001005SANT/Myb domain
CDDcd001671.66E-8108153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MSSNETPSLQ TQWSWYENKT FEVALTEYPE GTPNRWPLIT AKLSGKSLCQ VLDHYRALIH  60
DLELIDSGKV ETPNYRYDDN SDRSNMAPKQ HPTTARSGRG EERRKSVPWT EKEHRLFLKG  120
LAAYGKGDWK NISRNSVVTK TSSQVASHAQ KFFNRRQQNK ESKRKSIHDI TDP
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936185.11e-128transcription factor DIVARICATA
SwissprotQ8S9H75e-41DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A3Q0I0I66e-75A0A3Q0I0I6_PHODC; transcription factor DIVARICATA-like
STRINGXP_008789580.11e-75(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-48MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]