PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010934813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 290aa    MW: 32404.2 Da    PI: 7.0625
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010934813.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-141562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d+  ++G  +W++++ + g+ R +k+c++rw +yl
   XP_010934813.1 15 KGLWSPEEDQKLRDYMLKHGHSCWSAVPVKAGLQRKGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding54.52.7e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE+e + ++ ++lG++ W++Ia +++ gRt++++k++w++yl
   XP_010934813.1  68 RGFFSQEEEETIMNLQAKLGNK-WSRIAMHLP-GRTDNEVKNYWNSYL 113
                      789*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.1621062IPR017930Myb domain
SuperFamilySSF466893.48E-2712109IPR009057Homeodomain-like
SMARTSM007178.2E-101464IPR001005SANT/Myb domain
PfamPF002491.3E-121562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-211669IPR009057Homeodomain-like
CDDcd001675.88E-91862No hitNo description
PROSITE profilePS5129426.78763117IPR017930Myb domain
SMARTSM007171.4E-1567115IPR001005SANT/Myb domain
PfamPF002496.8E-1569113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2570117IPR009057Homeodomain-like
CDDcd001675.12E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGCRTCETPK VNYRKGLWSP EEDQKLRDYM LKHGHSCWSA VPVKAGLQRK GKSCRLRWIN  60
YLRPGLKRGF FSQEEEETIM NLQAKLGNKW SRIAMHLPGR TDNEVKNYWN SYLKKKVINA  120
QGSDPHGSAT KSPDSTNQSQ VTHAETIYKI SSSESIEPPG SSTRDLSPSM MHRMEFGSFK  180
GASHQHFPKV FADWLSVDQV IDQSSGSFVH ANTPWNSNNS NIDEVLKPGS SQVVADSKSD  240
LLSGYGDSGI YGELQAQLEP ASQTLGDEFF DLLSLGEISV SLDTNHDVLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-24151177108B-MYB
1h8a_C1e-23911723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934813.10.0transcription factor LAF1
SwissprotQ8LPH61e-53MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A2H3Z1N20.0A0A2H3Z1N2_PHODC; transcription repressor MYB6
STRINGXP_008780142.11e-154(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.11e-56myb domain protein 19