PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010933430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 365aa    MW: 40630.2 Da    PI: 4.6015
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010933430.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l  +++++G g+W++ +++ g+ R++k+c++rw +yl
   XP_010933430.1 16 KGSWTPEEDIRLMSYIQKYGHGNWRALPKKAGLLRCGKSCRLRWINYL 63
                     799*****************************99************97 PP

2Myb_DNA-binding53.65.1e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
   XP_010933430.1  69 RGNFTQEEEETIIKLHGLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1681163IPR017930Myb domain
SuperFamilySSF466896.74E-3113110IPR009057Homeodomain-like
SMARTSM007175.0E-131565IPR001005SANT/Myb domain
PfamPF002496.3E-161663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-251770IPR009057Homeodomain-like
CDDcd001676.20E-101863No hitNo description
PROSITE profilePS5129425.04864118IPR017930Myb domain
SMARTSM007175.2E-1568116IPR001005SANT/Myb domain
PfamPF002494.4E-1569114IPR001005SANT/Myb domain
CDDcd001672.34E-1071114No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2671118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGRGRAPCCE KVGLNKGSWT PEEDIRLMSY IQKYGHGNWR ALPKKAGLLR CGKSCRLRWI  60
NYLRPDIKRG NFTQEEEETI IKLHGLLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRLLS  120
RDQSQKTDKL EETPSSPSST TTNSSSDRGE GKSDSEHTNP SVDSTNSSED KIEIPIEPSM  180
DIWLMLEDAL PSSPQKTDTE DKNMWELQLE PNSLKVSPCS SPSHSLATNG RTSGGGRGVQ  240
ALNDTDMREA EKDPLEIPDV PIELELWDMI EDGDAGLFSP GVGAMEELGV HGNPTSLHEE  300
SSREEGSTIW LEYLEKELGL WGASDDNQEC LMSPWTEMEG DPVSCYFQKG PSSTSPLDLH  360
DLKVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933430.10.0myb-related protein Zm1-like
TrEMBLA0A2H3X0Z80.0A0A2H3X0Z8_PHODC; myb-related protein Zm1-like
STRINGXP_008776690.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-68myb domain protein 63