PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010932223.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 243aa    MW: 26962.2 Da    PI: 7.1325
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010932223.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.2e-19752147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++++ +G+++W++I++ ++ gR++k+c++rw + 
   XP_010932223.1  7 KGPWSPEEDEALRRLIEIHGPRNWSAISKGVP-GRSGKSCRLRWCNQ 52
                     79******************************.***********985 PP

2Myb_DNA-binding54.33.1e-1761101345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eEde +v+a++++G++ W+tIar +  gRt++ +k++w+
   XP_010932223.1  61 PFTAEEDEAIVRAHRRFGNK-WATIARLLA-GRTDNAVKNHWN 101
                      89******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.219257IPR017930Myb domain
SuperFamilySSF466893.03E-315100IPR009057Homeodomain-like
SMARTSM007176.8E-18655IPR001005SANT/Myb domain
PfamPF002498.1E-19752IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-25860IPR009057Homeodomain-like
CDDcd001674.02E-16951No hitNo description
SMARTSM007175.0E-1558106IPR001005SANT/Myb domain
PROSITE profilePS5129420.50859108IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-2261108IPR009057Homeodomain-like
PfamPF002497.2E-1461101IPR001005SANT/Myb domain
CDDcd001671.60E-1161104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MMEERIKGPW SPEEDEALRR LIEIHGPRNW SAISKGVPGR SGKSCRLRWC NQLSPVVEHR  60
PFTAEEDEAI VRAHRRFGNK WATIARLLAG RTDNAVKNHW NATLKRRLSS PSDDDGDLNK  120
RCRSTPSRSD ASDFSGSSSP PPPPPPGGED DPMTALTLAL PGYGSDSGKE ETAAGVGGIR  180
LPPEMEGAMR EMVRREVRSH MEGRGYGVPE GAGVMGQIIW EEVRNYIAEL GKTRYDVPVD  240
WQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-3841081105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932223.11e-178transcription factor MYB77
SwissprotO231605e-59MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A2H3YCL71e-124A0A2H3YCL7_PHODC; transcription factor MYB77-like
STRINGXP_008796508.11e-125(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-61myb domain protein r1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]