PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010931268.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 203aa MW: 23129.6 Da PI: 10.1708 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.9 | 4.7e-18 | 62 | 108 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT++Ede l +av+ + g++Wk+Ia+ ++ Rt+ qc +rwqk+l XP_010931268.1 62 KGGWTPQEDETLRKAVETYKGRCWKKIAEFFP-DRTEVQCLHRWQKVL 108 688*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 63.4 | 4.4e-20 | 114 | 160 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEde+++++v+++G+ W+ Ia+ ++ gR +kqc++rw+++l XP_010931268.1 114 KGPWTLEEDEKIINLVQKYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 160 79******************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 35.7 | 1.9e-11 | 166 | 198 | 1 | 35 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35 +++WT eE++ l +a++++G++ W+ Ia+ ++ gR XP_010931268.1 166 KDAWTVEEELTLMNAHRMHGNK-WAEIAKLLP-GR 198 689*******************.*********.98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.678 | 57 | 108 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.46E-16 | 58 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.6E-16 | 61 | 110 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-16 | 62 | 108 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-23 | 64 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.12E-13 | 65 | 108 | No hit | No description |
PROSITE profile | PS51294 | 30.901 | 109 | 164 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.17E-28 | 111 | 198 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.0E-18 | 113 | 162 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.1E-19 | 114 | 160 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.68E-15 | 116 | 160 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-27 | 117 | 164 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.7E-13 | 165 | 198 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.665 | 165 | 203 | IPR017930 | Myb domain |
SMART | SM00717 | 0.81 | 165 | 202 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-10 | 166 | 198 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.47E-6 | 168 | 198 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MEVMAAVKIE QSCIENKQSA AASSSSLSEG SYGFSRMSPA VSSPATSSPS HRRTSGPIRR 60 AKGGWTPQED ETLRKAVETY KGRCWKKIAE FFPDRTEVQC LHRWQKVLNP ELIKGPWTLE 120 EDEKIINLVQ KYGPTKWSVI AKSLPGRIGK QCRERWHNHL NPLIKKDAWT VEEELTLMNA 180 HRMHGNKWAE IAKLLPGRFI VLH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 3e-64 | 61 | 198 | 5 | 142 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 3e-64 | 61 | 198 | 5 | 142 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00482 | DAP | Transfer from AT5G02320 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by ethylene, auxin (IAA), jasmonic acid (JA) and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010931265.1 | 1e-136 | transcription factor MYB3R-3 isoform X1 | ||||
Refseq | XP_010931266.1 | 1e-136 | transcription factor MYB3R-3 isoform X1 | ||||
Swissprot | Q8H1P9 | 1e-111 | MB3R3_ARATH; Transcription factor MYB3R-3 | ||||
TrEMBL | A0A2H3YRH4 | 1e-135 | A0A2H3YRH4_PHODC; transcription factor MYB3R-3 | ||||
STRING | XP_008802730.1 | 1e-135 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09370.1 | 1e-95 | myb domain protein 3r-3 |
Publications ? help Back to Top | |||
---|---|---|---|
|