PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010926839.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 203aa MW: 23187.4 Da PI: 8.0282 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80 | 1.6e-25 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+k rqvtfskRr g++KKA EL vLCdaev +i+fs++gk ye++s XP_010926839.1 10 RIEDKASRQVTFSKRRGGLFKKARELAVLCDAEVGLIVFSPSGKPYEFCS 59 8***********************************************96 PP | |||||||
2 | K-box | 29.7 | 2.8e-11 | 114 | 168 | 42 | 96 |
K-box 42 dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 d+ +L+++eL+qLe++L ++ k+i s+K++l+++ i++ q ++ + ++ ++L+ XP_010926839.1 114 DIAELDVNELEQLEKELSDASKQIQSRKTKLMMDTINKFQDEKRLMMDTINKLQD 168 899*************************************999998888888876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.109 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.1E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.04E-41 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 1.09E-31 | 3 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.5E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 7.836 | 70 | 183 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.7E-6 | 114 | 169 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MRRGKVQIRR IEDKASRQVT FSKRRGGLFK KARELAVLCD AEVGLIVFSP SGKPYEFCSS 60 SSMEDTITRY EQISDAGQDV SKNIDKEQNH GKDFACPTIN SKLMKQSPWS LETDIAELDV 120 NELEQLEKEL SDASKQIQSR KTKLMMDTIN KFQDEKRLMM DTINKLQDER KTMLEEKRFL 180 ESVRKKCCGD GAEWSCSGAP QGC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-18 | 1 | 91 | 1 | 95 | MEF2C |
5f28_B | 1e-18 | 1 | 91 | 1 | 95 | MEF2C |
5f28_C | 1e-18 | 1 | 91 | 1 | 95 | MEF2C |
5f28_D | 1e-18 | 1 | 91 | 1 | 95 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010926839.1 | 1e-149 | MADS-box transcription factor 51 isoform X2 | ||||
Swissprot | Q9XJ61 | 3e-41 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
TrEMBL | A0A2H3YZX5 | 3e-88 | A0A2H3YZX5_PHODC; MADS-box transcription factor 51-like isoform X1 | ||||
STRING | XP_008806426.1 | 5e-89 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15800.1 | 7e-41 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|