PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010920799.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 275aa    MW: 29693.6 Da    PI: 8.5081
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010920799.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd ll ++v+++G+++W++I++ ++ gR++k+c++rw + 
   XP_010920799.1 19 KGSWSPEEDALLMRLVERHGPRNWTLISSGIP-GRSGKSCRLRWCNQ 64
                     799*****************************.***********985 PP

2Myb_DNA-binding55.11.8e-1773115347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ed  +v a++++G++ W+tIar ++ gRt++ +k++w++ 
   XP_010920799.1  73 PFTPSEDAAIVAAHAKYGNK-WATIARLLP-GRTDNAIKNHWNST 115
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.331469IPR017930Myb domain
SuperFamilySSF466899.36E-3117112IPR009057Homeodomain-like
SMARTSM007173.7E-161867IPR001005SANT/Myb domain
PfamPF002491.0E-181964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-242072IPR009057Homeodomain-like
CDDcd001674.24E-152163No hitNo description
PROSITE profilePS5129421.60770120IPR017930Myb domain
SMARTSM007172.5E-1570118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2273119IPR009057Homeodomain-like
CDDcd001671.69E-1273116No hitNo description
PfamPF002492.1E-1473115IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MVVMDGGGVG RVDGDPRIKG SWSPEEDALL MRLVERHGPR NWTLISSGIP GRSGKSCRLR  60
WCNQLSPAVH HRPFTPSEDA AIVAAHAKYG NKWATIARLL PGRTDNAIKN HWNSTLRRRR  120
RAAEAAASPA VPLPVPLPHA ADSTDPEESD SESATKRPCR RDEVSGSEVA TVVAALPAPP  180
PPPPPPPPPP PMARIPADPV TSLTLCPPGE GAGGGDGRER REGRWDAEMR EMCFVSIMRE  240
MIAEEVRSYI NRLLSEGGGA TRIIVKSDSA SNRQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-37181193104MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-361811957158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-361811957158MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-37181193104C-Myb DNA-Binding Domain
1msf_C4e-37181193104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920799.10.0transcription factor MYB77
TrEMBLA0A2H3Y3181e-126A0A2H3Y318_PHODC; transcription factor MYB77-like
STRINGXP_008792655.11e-127(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-53myb domain protein 73