PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010919081.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 217aa MW: 24700.1 Da PI: 7.3092 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.6 | 1.1e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye+ss XP_010919081.1 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 73.5 | 6e-25 | 78 | 171 | 5 | 98 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++++++e++ ++++ e+a + ++ie+L+ ++R+ll e+Les+s++eL+++e +Le+sl++iR +Kn+ll eqi +l++ke+ l++en+ L++k XP_010919081.1 78 NNNEVTEQNIQQCKFEAASMSRKIESLEASKRKLLAESLESCSVEELHEIEGKLEQSLRNIRGRKNQLLGEQIAQLKEKEQTLEKENTLLQEKC 171 456699*************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.3E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.282 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.01E-33 | 3 | 81 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.07E-42 | 3 | 70 | No hit | No description |
PRINTS | PR00404 | 2.5E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.3E-26 | 83 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.44 | 87 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000060 | Biological Process | protein import into nucleus, translocation | ||||
GO:0009409 | Biological Process | response to cold | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MVRGKTEIKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGKLYEFSST 60 SMQKTINRYR MHAKSGINNN EVTEQNIQQC KFEAASMSRK IESLEASKRK LLAESLESCS 120 VEELHEIEGK LEQSLRNIRG RKNQLLGEQI AQLKEKEQTL EKENTLLQEK CKLQSQPPLA 180 DLEEADPDEQ DGQHNEVETE LYIGCPGRGR INCMSPS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-19 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00076 | ChIP-chip | Transfer from AT2G45660 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010919080.1 | 1e-157 | MADS-box protein SOC1 isoform X1 | ||||
Swissprot | Q9XJ60 | 2e-85 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
TrEMBL | A0A2H3XGK8 | 1e-128 | A0A2H3XGK8_PHODC; MADS-box transcription factor 50-like | ||||
STRING | XP_008783455.1 | 1e-129 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45660.1 | 3e-70 | AGAMOUS-like 20 |