PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010915442.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 246aa MW: 28560.5 Da PI: 10.1328 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.3 | 1.5e-31 | 43 | 92 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ XP_010915442.1 43 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 92 79***********************************************8 PP | |||||||
2 | K-box | 75.2 | 1.8e-25 | 111 | 200 | 4 | 93 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 s++ s++ea+++++qqe++kL+++i +Lq+++R+l+Ge+L+s+s ++L+qLe +Lek+++kiR+kK++ + q ++ ++k +++e + XP_010915442.1 111 SNSGSVSEADSQYYQQESTKLRQQIISLQNSNRNLMGESLGSMSPRDLKQLEGRLEKGINKIRTKKKREVELQNANMYLRNKIAENERAQ 200 444559***********************************************************9987777766665555555555443 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-42 | 35 | 94 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 34.132 | 35 | 95 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.57E-44 | 36 | 104 | No hit | No description |
SuperFamily | SSF55455 | 4.32E-33 | 36 | 107 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.5E-33 | 37 | 57 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 37 | 91 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.2E-27 | 44 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.5E-33 | 57 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.5E-33 | 72 | 93 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.6E-18 | 118 | 198 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.467 | 121 | 209 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
MIISPSRSQF HPLIRLWCEG RRSQEVAALE RPEKMGRGKI EIKRIENTTN RQVTFCKRRN 60 GLLKKAYELS VLCDAEVALI VFSSRGRLYE YANNSVKATI ERYKRACTDT SNSGSVSEAD 120 SQYYQQESTK LRQQIISLQN SNRNLMGESL GSMSPRDLKQ LEGRLEKGIN KIRTKKKREV 180 ELQNANMYLR NKIAENERAQ QQMNMLPQTT EYEVMAPYDS RNFLQVNLMQ SNQHYSHQQQ 240 TTLQLG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6byy_A | 4e-21 | 35 | 103 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 4e-21 | 35 | 103 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 4e-21 | 35 | 103 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 4e-21 | 35 | 103 | 1 | 69 | MEF2 CHIMERA |
6c9l_A | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-21 | 35 | 103 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010915446.1 | 1e-151 | MADS-box transcription factor 3 isoform X2 | ||||
Refseq | XP_019705068.1 | 1e-151 | MADS-box transcription factor 3 isoform X2 | ||||
Swissprot | Q40704 | 1e-111 | MADS3_ORYSJ; MADS-box transcription factor 3 | ||||
TrEMBL | Q2NNC3 | 1e-148 | Q2NNC3_ELAGV; MADS box transcription factor | ||||
STRING | XP_008791911.1 | 1e-137 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-103 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|