PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010914802.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 403aa    MW: 44533 Da    PI: 6.7668
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010914802.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
   XP_010914802.1 14 KGLWSPEEDEKLLKHITKYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding44.73e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
   XP_010914802.1  67 RGSFSQQEEDLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.299965IPR017930Myb domain
SuperFamilySSF466891.91E-2912108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-151461IPR001005SANT/Myb domain
CDDcd001674.93E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.4E-2565116IPR009057Homeodomain-like
SMARTSM007172.0E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129420.01766116IPR017930Myb domain
PfamPF002493.7E-1367110IPR001005SANT/Myb domain
CDDcd001675.85E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLKHIT KYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SQQEEDLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQRG  120
IDPNTHKPLS ETEGGEDKAG SSELKPLAPP SGNLNSVVPE FAPPVMSMVD RSNSENLVTS  180
TKDFFLYRFA AASHESSSSC QPTNSMDYLP LRNSTYSPSS SMDQNLPLWF NQNSRLPDMN  240
PEFTCNMMMT AALPSGSRST ASTSMGLKPT VGMAADNSLP GFQCLEAGNS SNNSASSGNS  300
GGGGIELQSN NSIYESSIFQ WSDLVSNRQA EIQLGAEPED LKWSEYLNGT IPLSADIQNQ  360
TQLLNGAVKE ENQFPIDGLS SWLQPPEVFG KDLQRISTAF KQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010914802.10.0transcription factor MYB61
TrEMBLA0A2H3Z3R00.0A0A2H3Z3R0_PHODC; transcription factor MYB61-like
STRINGXP_008807932.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.14e-93myb domain protein 61