PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010914215.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25774.3 Da PI: 7.8562 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.5 | 3.1e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien +nrqvtfskRr g+lKKA+EL +LCd++v v+ifss+gk++eyss XP_010914215.1 9 KRIENPTNRQVTFSKRRGGLLKKANELAILCDVQVGVVIFSSSGKMFEYSS 59 79***********************************************96 PP | |||||||
2 | K-box | 66.5 | 9.2e-23 | 80 | 152 | 26 | 98 |
K-box 26 keienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +ei+n q + R++ GedL+s+++++L+qLeqqLe s++k+R++K++ll +q+++l++ke+ l+++n L + l XP_010914215.1 80 EEIDNQQASMRQYTGEDLSSMTMNDLNQLEQQLEYSVNKVRTRKHQLLNQQLDNLRRKEHILEDQNSHLYRIL 152 789999*************************************************************998765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.5E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.637 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.49E-44 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 4.97E-33 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.9E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.9E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.9E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 14.6 | 68 | 158 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 8.3E-23 | 80 | 150 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008360 | Biological Process | regulation of cell shape | ||||
GO:0019252 | Biological Process | starch biosynthetic process | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:2000029 | Biological Process | regulation of proanthocyanidin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MGRGKIEIKR IENPTNRQVT FSKRRGGLLK KANELAILCD VQVGVVIFSS SGKMFEYSSP 60 PLSMHQIIDR YQRVTNTRFE EIDNQQASMR QYTGEDLSSM TMNDLNQLEQ QLEYSVNKVR 120 TRKHQLLNQQ LDNLRRKEHI LEDQNSHLYR ILSEHQAAME HQQAAMEHKV PDVPMLEPFG 180 LFYQDEPSRN LLQLSPQLHA FRLQPAQPNL QEASLPGHSL QL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-19 | 1 | 71 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 2e-19 | 1 | 71 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 2e-19 | 1 | 71 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 2e-19 | 1 | 71 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 2e-19 | 1 | 71 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 2e-19 | 1 | 71 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 2e-19 | 1 | 71 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 2e-19 | 1 | 71 | 1 | 69 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010914215.1 | 1e-164 | MADS-box transcription factor 29 isoform X3 | ||||
Swissprot | Q6H711 | 9e-93 | MAD29_ORYSJ; MADS-box transcription factor 29 | ||||
TrEMBL | A0A2H3Z3T1 | 1e-148 | A0A2H3Z3T1_PHODC; MADS-box protein AeAP3-2-like | ||||
STRING | XP_008807981.1 | 1e-149 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 7e-41 | MIKC_MADS family protein |