Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 97.1 | 7.3e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krienk+nrqvtfskRr g+lKKA+ELSvLCdae+a+iifss+gklye+
XP_010911080.1 9 KRIENKINRQVTFSKRRSGLLKKAYELSVLCDAEIALIIFSSRGKLYEFG 58
79**********************************************95 PP
|
2 | K-box | 106.8 | 2.5e-35 | 76 | 171 | 4 | 99 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
s++++ +++++++++qe+akLk++ e+Lqr+qRhllGedL++L++keLqqLe+qLe++l++ R++K +++l+q+eel+kke+ l e+nk+L+ +l
XP_010911080.1 76 SQDSNFADQETQNWYQEMAKLKAKFESLQRSQRHLLGEDLGPLTVKELQQLERQLESALSQARQRKAQIMLDQMEELRKKERHLGEINKQLKDRL 170
56677899***********************************************************************************9887 PP
K-box 99 e 99
+
XP_010911080.1 171 D 171
6 PP
|
Protein Features
? help Back to Top |
|
Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
SMART | SM00432 | 9.0E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.123 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.90E-44 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 7.46E-34 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.8E-31 | 84 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.377 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0009553 | Biological Process | embryo sac development |
GO:0009911 | Biological Process | positive regulation of flower development |
GO:0010094 | Biological Process | specification of carpel identity |
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem |
GO:0010582 | Biological Process | floral meristem determinacy |
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
GO:0048455 | Biological Process | stamen formation |
GO:0048459 | Biological Process | floral whorl structural organization |
GO:0048509 | Biological Process | regulation of meristem development |
GO:0048833 | Biological Process | specification of floral organ number |
GO:0080060 | Biological Process | integument development |
GO:0080112 | Biological Process | seed growth |
GO:0005634 | Cellular Component | nucleus |
GO:0003677 | Molecular Function | DNA binding |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0046983 | Molecular Function | protein dimerization activity |