PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.K00202.2.p | ||||||||
Common Name | EUGRSUZ_K00202 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 217aa MW: 24551 Da PI: 10.466 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88.4 | 3.8e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqvtfskRr g+lKKA+ELSvLCdaeva iifs++g+lye+ss Eucgr.K00202.2.p 10 RIENVTSRQVTFSKRRPGLLKKAYELSVLCDAEVATIIFSQKGRLYEFSS 59 8***********************************************96 PP | |||||||
2 | K-box | 75 | 2.1e-25 | 83 | 172 | 9 | 98 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + +++ +l+qe ++++++ie L+ ++R+l G++L+s+s+ e+q++ +qLe+sl++iR++K +l+ +qi++lq ke++l+een +L +k+ Eucgr.K00202.2.p 83 NIKQNILRLKQETTNMERKIELLEVSLRKLSGQCLGSCSMDEIQEIGDQLERSLSSIRERKAQLFNDQIRQLQAKERSLKEENAKLLAKV 172 456788899*****************************************************************************9997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.7E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.132 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.19E-37 | 3 | 79 | No hit | No description |
SuperFamily | SSF55455 | 5.1E-30 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.356 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.1E-22 | 90 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MVRGKVQMRR IENVTSRQVT FSKRRPGLLK KAYELSVLCD AEVATIIFSQ KGRLYEFSSN 60 SEIRKTIDRY RRSTNDAATY QANIKQNILR LKQETTNMER KIELLEVSLR KLSGQCLGSC 120 SMDEIQEIGD QLERSLSSIR ERKAQLFNDQ IRQLQAKERS LKEENAKLLA KVSPSFPSCL 180 ANPGQSTTHP RATTIHSQSS PSTDGETRLF IGLPKS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 9e-17 | 1 | 70 | 1 | 69 | MEF2C |
5f28_B | 9e-17 | 1 | 70 | 1 | 69 | MEF2C |
5f28_C | 9e-17 | 1 | 70 | 1 | 69 | MEF2C |
5f28_D | 9e-17 | 1 | 70 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.K00202.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY263808 | 1e-163 | AY263808.1 Eucalyptus grandis SOC1-like floral activator MADS4 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010035071.1 | 1e-149 | PREDICTED: MADS-box protein AGL42 isoform X2 | ||||
Swissprot | Q9FIS1 | 5e-71 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A058ZYA2 | 1e-156 | A0A058ZYA2_EUCGR; Uncharacterized protein | ||||
STRING | XP_010035071.1 | 1e-149 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 2e-73 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.K00202.2.p |